Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Ethyl+3-isopropylpicolinate


176,331  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"176331"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (76480-512)

Supplier:  AAT BIOQUEST INC
Description:   Rhodamine 6G is also called Rhodamine 590, R6G, Basic Rhodamine Yellow, or C.I.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  AMBEED, INC
Description:   3-Ethyl-4-methyl-2,5-dihydro-1H-pyrrol-2-one, Purity: 98%, CAS Number: 766-36-9, Appearance: Form: Crystal - Powder / Colour: White - Yellow-green, Storage: Sealed in dry, Room Temperature, Size: 5g

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [BTN/36] antibody to Biotin for Flow Cytometry, IF, WB and IHC-P.
Catalog Number: (RL000-001-K45)

Supplier:  Rockland Immunochemical
Description:   Histone H4 Peptide Unconjugated
Supplier:  AMBEED, INC
Description:   1-Methylpyrazole, Purity: 98%, CAS Number: 930-36-9, Appearance: Colorless to Yellow Liquid, Storage: Inert atmosphere, Room Temperature, Size: 10g
Supplier:  Spectrum Chemicals
Description:   Zinc salicylate trihydrate ≥95.0%
Small Business Enterprise
Catalog Number: (102551-566)

Supplier:  Matrix Scientific
Description:   (1Z)-N'-HYDROXYPROPANIMIDAMIDE HYDROCHLORIDE MF=C3H8N2O MW=88.11 CAS=29335-36-2 MDL=MFCD13250108
Supplier:  Thermo Scientific Chemicals
Description:   Grade: 98+. Melting Point C. Boiling Point C: 180-182*. C7H14N2. 13961-36-9. FLAMMABLE CORROSIVE AIR SENSITIVE
MSDS SDS
Supplier:  AMBEED, INC
Description:   2,6-Di-tert-butyl-4-vinylphenol, Purity: 95%, CAS Number: 19263-36-6, Appearance: Solid or liquid, Storage: Inert atmosphere, 2-8 C, Size: 250mg
Supplier:  Thermo Scientific Chemicals
Description:   98% 10G
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Acridine orange (hemizinc salt) ∼55% (dye content), pure
Supplier:  AOB CHEM USA
Description:   1-(3-Isopropylphenyl)cyclopentanol ≥95%
New Product
Supplier:  AMBEED, INC
Description:   1-(4-(4-Propionylpiperazin-1-yl)-3-(trifluoromethyl)phenyl)-9-(quinolin-3-yl)benzo[h][1,6]naphthyridin-2(1H)-one, Purity: 98%, CAS Number: 1222998-36-8, Appearance: White to yellow or gray powder or crystals, Storage: Sealed in dry, Store in freezer, under -20 C, Size: 10mg

Supplier:  Anaspec Inc
Description:   In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4111.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Matrix Scientific
Description:   MF=C7H16N2O2 MW=160.22 CAS=452105-36-1 MDL=MFCD08059563 5G
Supplier:  AMBEED, INC
Description:   Ethyl 2-Amino-4-phenylthiophene-3-carboxylate, Purity: 96%, CAS Number: 4815-36-5, Appearance: Form: solid, Storage: Keep in dark place, Sealed in dry, 2-8 C, Size: 250mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
257 - 272  of 176,331