Ethephon(2-chloroethylphosphonic+acid)
Supplier:
ALADDIN SCIENTIFIC
Description:
2-Aminoterephthalic acid can be used to synthesize:· Lanthanide coordination polymers with 1,10-phenanthroline by hydrothermal method.· Blue-emitting derivatives of 2-aminoterephthalic acid.· Amino-functionalized Zr-terephthalate (UiO-66), an excellent catalyst for selective synthesis of jasminaldehyde.· IRMOF-3, a zinc aminoterephthalate metal-organic framework useful as a catalyst for the Knoevenagel condensation of benzaldehyde and ethyl cyanoacetate.· Polymeric composite membrane with excellent CO2 separation capabilities.
Catalog Number:
(10062-648)
Supplier:
Prosci
Description:
15 amino acid peptide near the carboxy terminus of human PIBF1.
Catalog Number:
(10277-288)
Supplier:
Bioss
Description:
The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319 amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213 amino acid extracellular region, a single transmembrane domain, and a 62 amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily.
Supplier:
BeanTown Chemical
Description:
CAS: 56-85-9; EC No: 200-292-1; MDL No: MFCD00008044; RTECS: MA2275100
Powder; Molecular Formula: C5H10N2O3; MW: 146.14
Melting Point: 185° (decomposes)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 041958-1G , MDL Number: MFCD01863049
Catalog Number:
(TCD2539-5G)
Supplier:
TCI America
Description:
CAS Number: 26774-88-9
MDL Number: MFCD00137746 Molecular Formula: C8H11NO2 Molecular Weight: 153.18 Purity/Analysis Method: >97.0% (T) Form: Crystal Specific rotation [a]20/D: -155 deg (C=1, 1mol/L HCl)
Catalog Number:
(75790-194)
Supplier:
Prosci
Description:
Syndecan-1 is a single-pass type I membrane protein that belongs to the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. Human SDC1 is synthesized as a 310 amino acid precursor that contains a 22 amino acid signal sequence, and a 288 amino acid mature chain. The Syndecan-1 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered Syndecan-1 expression has been detected in several different tumor types.
Supplier:
Spectrum Chemicals
Description:
L-Histidine, FCC - The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
![]()
Catalog Number:
(80057-656)
Supplier:
MilliporeSigma
Description:
L-3,3'',5-Triiodothyronine, Free Acid, High Purity. (T3). Beige solid. PROTECT FROM LIGHT. Chromatographically purified. Purity: >= 99% by HPLC. Soluble in 100 mM NaOH. RTECS AY6750000, CAS 6893-02-3, M.W. 651.0.
Supplier:
AMBEED, INC
Description:
(S)-2-Amino-5-guanidinopentanoic acid hydrochloride, Purity: 98+%, CAS Number: 1119-34-2, Appearance: Form: Crystal - Powder/Colour: White, Storage: Inert atmosphere, Room Temperature, Size: 1000g
Catalog Number:
(103006-440)
Supplier:
Anaspec Inc
Description:
This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ MW: 4759.4 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(101811-070)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 020948-500MG , MDL Number: MFCD08059796
Supplier:
Enzo Life Sciences
Description:
Produced in <i>E. coli.</i> Non-glycosylated protein, containing 165 amino acids.
Supplier:
BeanTown Chemical
Description:
CAS: 150-25-4; EC No: 205-755-1; MDL No: MFCD00004295; RTECS: MB9700000
Powder; Molecular Formula: C6H13NO4; MW: 163.17
Catalog Number:
(10081-290)
Supplier:
Proteintech
Description:
The MAOB gene encodes a 520-amino acid protein with a molecular mass of 58.8 kD and shows 70% amino acid identity to MAOA. MAOA and MAOB are present in the outer mitochondrial membrane in the central nervous system and peripheral tissues.A comparison of highly purified human placental MAOA and human liver MAOB revealed that the A form of the enzyme is larger by 2 kDa and only one potential N-glycosylation site exists in each protein, with each site in a different relevant position .
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||