Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Boc-Cys(SEt)-OH·DCHA


39,106  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"39106"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103007-672)

Supplier:  Anaspec Inc
Description:   This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   3-(2,6-Dimethylphenyl)cyclohexanone ≥97%
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human IFN-alpha 1 Protein, His Tag, ACROBiosystems
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Cysteaminium chloride 98%
Catalog Number: (76704-708)

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Cystatin C(Cys-C) ELISA Kit
Supplier:  ACROBIOSYSTEMS INC MS
Description:   Human IFN-alpha 1 Protein, Fc Tag, ACROBiosystems
Supplier:  Biotium
Description:   Revolutionary technology allows antibody labeling with Cyanine 555 (Cy®3) or Cyanine 647 (Cy®5) in 30 minutes without a purification step. The labeling procedure tolerates many common buffer components and antibody stabilizers.
Supplier:  Bachem Americas
Description:   c(RADfC), control peptide for the αvβ3 integrin binding cyclic RGD peptide c(RGDfC) (H-7226).
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041835-5G , MDL Number: MFCD01860623
Catalog Number: (89367-420)

Supplier:  Genetex
Description:   Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, particularly amino-terminal region containing active site cysteine residue, and the thiolspecific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx6 belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx1, 2, and 6 in cytosol, Prx3 in mitochondria, Prx 4 in ER and secretion, Prx 5 showing complicated distribution including peroxisome, mitochondria and cytosol.
Catalog Number: (RL000-001-M48)

Supplier:  Rockland Immunochemical
Description:   HIV tat protein Control Peptide
Supplier:  Thermo Scientific Chemicals
Description:   Nonyl Beta-D-Glucopyranoside, Purity: 98%, CAS Number: 69984-73-2, Molecular Formula: C15H30O6, Form: Powder, Synonym: Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys (Disulfide bridge: Cys34-Cys43), Size: 1g

Supplier:  Rockland Immunochemical
Description:   Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Supplier:  Thermo Scientific Chemicals
Description:   N-Fmoc-S-trityl-L-cysteine pentafluorophenyl ester, Purity: 98%, CAS Number: 115520-21-3, molecular formula: C43H30F5NO4S, Synonyms: Fmoc-Cys(Trt)-Opfp, 1g
MSDS SDS
Supplier:  MilliporeSigma
MSDS SDS
Supplier:  AMBEED, INC
Description:   Boc-2-chloro-D-phenylalanine 97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,569 - 1,584  of 39,106