Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-(3,4-Difluorophenyl)ethanol


25,295  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"25295"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   (3aS,3'aS,8aR,8'aR)-2,2'-Cyclohexylidenebis[3a,8a-dihydro-dihydro-8H-indeno[1,2-d]oxazole, Purity: 95% 99%ee, CAS Number: 2341858-19-1, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 100MG
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 058207-1G , MDL Number: MFCD08235018
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 056410-1G , MDL Number: MFCD16710271
Catalog Number: (75791-126)

Supplier:  Prosci
Description:   Interleukin-22(IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.
Supplier:  AOB CHEM USA
Description:   1-(3,5-Difluoro-4-methylphenyl)-2,2-difluoroethanone ≥95%
Supplier:  AOB CHEM USA
Description:   1-(2,5-Difluoro-4-methoxyphenyl)-2,2-difluoroethanone ≥97%
Supplier:  AMBEED, INC
Description:   2,2-Dimethyl-4-oxo-3,8,11-trioxa-5-azatridecan-13-yl 4-methylbenzenesulfonate, Purity: 95%, CAS Number: 206265-94-3, Appearance: Solid or semi-solid or liquid, Storage: Inert atmosphere, 2-8C, Size: 1G
Supplier:  AMBEED, INC
Description:   1-(4-Chloro-3-(trifluoromethyl)phenyl)-3-(2,2-difluorobenzo[d][1,3]dioxol-5-yl)urea, Purity: 98%, CAS Number: 2165324-62-7, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 5MG

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 026159-250MG , MDL Number: MFCD07367901

Supplier:  AMBEED, INC
Description:   3-Bromo-1-(2,2-difluoroethyl)-1H-pyrazole ≥97%
New Product
Supplier:  AMBEED, INC
Description:   (R)-2,2'-Bis[bis(3,5-trifluoromethylphenyl)phosphino]-4,4',6,6'-tetramethoxy)-1,1'-biphenyl, Purity: 98%, CAS Number: 1365531-84-5, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   (E)-1-((3aR,6S,7aS)-8,8-Dimethyl-2,2-dioxidohexahydro-1H-3a,6-methanobenzo[c]isothiazol-1-yl)but-2-en-1-one 97%
Supplier:  TCI America
Description:   CAS Number: 79-97-0
MDL Number: MFCD00002232
Molecular Formula: C17H20O2
Molecular Weight: 256.35
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 139
Flash Point (°C): 210
MSDS SDS
Supplier:  Strem Chemicals Inc
Description:   CAS #: 179866-74-1. Size: 1g.
Supplier:  TCI America
Description:   CAS Number: 75714-59-9 MDL Number: MFCD04038415 Molecular Formula: C22H16Br2O2 Molecular Weight: 472.18 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Melting point (°C): 185 Specific rotation [a]20/D: 12 deg (C=1, CHCl3)
MSDS SDS
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,833 - 6,848  of 25,295