Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+3,6-dibromo-2-fluorobenzoate


31,230  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"31230"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   1-Methoxy-1-trimethylsiloxy-2-methyl-1-propene Methyl trimethylsilyl dimethylketene acetal MTDA. Grade:95, Melting Point C. Boiling Point C:35-36*/15mm. C8H18O2Si. 31469-15-5. FLAMMABLE MOISTURE SENSITIVE
MSDS SDS
Supplier:  Dickies
Description:   Dickies® style WP924.
Supplier:  BeanTown Chemical
Description:   CAS: 13472-36-1; EC No: 231-767-1; MDL No: MFCD00149200; RTECS: UX7350000 Crystalline; Linear Formula: Na4P2O7·10H2O; MW: 446.06 Melting Point: 79.5° Density (g/mL): 1.82
MSDS SDS
Catalog Number: (76001-982)

Supplier:  Enzo Life Sciences
Description:   Pim1 inhibitor
Supplier:  Wearwell
Description:   Effective and easy-to-use PE mat offers economical dust and dirt control for low-profile carpet, tile, or concrete surfaces.
Catalog Number: (103229-124)

Supplier:  Novus Biologicals
Description:   MED4 Polyclonal Antibody, Host: Goat, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human MED4 Met80-Asp261, synonyms: Activator-recruited cofactor 36 kDa component, ARC36, DRIP36, Application: WB, IHC, Size: 25UG

Supplier:  Therapak, LLC
Description:   These products provide an ‘active’ solution for the transport of laboratory medical specimens.
Supplier:  Anaspec Inc
Description:   Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (AAJ60790-ME)

Supplier:  Thermo Scientific Chemicals
Description:   A phytoestrogen with antitumor, antioxidant, antiplatelet, anti-inflammatory effects. Inhibits cytochrome P450 1A1 (IC50 = 23 uM) and displays mixed agonist/antagonist actions at ER-alpha and ER-beta estrogen receptors
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   6-Methoxytryptamine 99%
Supplier:  TCI America
Description:   CAS Number: 452-69-7
Molecular Formula: C7H8FN
Molecular Weight: 125.15
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Boiling point (°C): 86
Melting point (°C): 36
Flash Point (°C): 104
MSDS SDS
Catalog Number: (TCC0304-25G)

Supplier:  TCI America
Description:   CAS Number: 98-15-7
MDL Number: MFCD00000594
Molecular Formula: C7H4ClF3
Molecular Weight: 180.55
Purity/Analysis Method: >90.0% (GC)
Form: Clear Liquid
Boiling point (°C): 139
Flash Point (°C): 36
Specific Gravity (20/20): 1.35
MSDS SDS
Supplier:  ALADDIN SCIENTIFIC
Description:   Apilimod mesylate ≥98% (by HPLC)
New Product
Catalog Number: (77283-716)

Supplier:  AMBEED, INC
Description:   N-Methoxy-N,4-dimethylbenzamide 95%
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043352-5G , MDL Number: MFCD05975052
Supplier:  MP Biomedicals
Description:   Standard agarose is a purified linear galactan hydrocolloid isolated from agar or agar-bearing marine algae with an Electroendoosmosis (EEO) value of 0.12 making it an essential component in chemical separation techniques.
Standard agarose is a very low electroendosmosis agarose (EEO) which is recommended for sharp resolution of nucleic acid fragments greater than 400 bp and up to 8000 bp. This Standard Agarose may be used at concentrations between 0.8 % and 2 %. Southern and Northern transfers can be performed efficiently from them.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,305 - 6,320  of 31,230