Text Search >
Ethyl+3,6-dibromo-2-fluorobenzoate
Print…
You Searched For:
31,220 results were found
Ethyl+3,6-dibromo-2-fluorobenzoate
Catalog Number:
(75928-872)
Supplier:
Rockland Immunochemical
Description:
IL-1RL2 is a member of the interleukin 1 receptor family, but it is incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity (1). Together with IL-1RAcP, it can bind members of the IL-36 cytokine family, leading to activation of the NF-kappaB pathway (2). IL-1RL2 can also bind to IL-1F10, resulting in a decreased product of Th17 cytokines in response to immunological or LPS challenge, suggesting that one potential role of IL-1RL2 may be to modulate the immune and inflammation response (3).
Supplier:
TCI America
Description:
CAS Number: 36791-04-5
MDL Number: MFCD00058564 Molecular Formula: C8H12N4O5 Molecular Weight: 244.21 Purity/Analysis Method: >98.0% (HPLC,N) Form: Crystal Color: White Specific rotation [a]20/D: -36 deg (C=1, H2O)
Supplier:
BeanTown Chemical
Description:
CAS: 75-18-3; EC No: 200-846-2; MDL No: MFCD00008562; RTECS: PV5075000
UN No: UN1164; Haz Class: 3; Packing Group: II
Liquid; Linear Formula: (CH3)2S; MW: 62.14
Melting Point: -98°; Boiling Point: 38°; Flash point: -36°C (-33°F)
Density (g/mL): 0.846; Refractive Index: 1.435
Supplier:
TCI America
Description:
(stabilized with Copper chip)
CAS Number: 3814-34-4 MDL Number: MFCD00000219 Molecular Formula: C6H13Br Molecular Weight: 165.07 Purity/Analysis Method: >97.0% (GC) Form: Clear Liquid Boiling point (°C): 145 Flash Point (°C): 36 Specific Gravity (20/20): 1.19
Supplier:
TCI America
Description:
CAS Number: 452-69-7
Molecular Formula: C7H8FN Molecular Weight: 125.15 Purity/Analysis Method: >98.0% (GC,T) Form: Crystal Boiling point (°C): 86 Melting point (°C): 36 Flash Point (°C): 104
Supplier:
Eagle Group
Description:
14 Gauge Type 304 stainless steel top with 4¹/₂" backsplash at rear of table.
Supplier:
BeanTown Chemical
Description:
CAS: 109-66-0; EC No: 203-692-4; MDL No: MFCD00009498; RTECS: RZ9450000
UN No: UN1265; Haz Class: 3; Packing Group: II
Liquid; Linear Formula: CH3(CH2)3CH3; Molecular Formula: C5H12; MW: 72.15
Melting Point: -130°; Boiling Point: 36°; Flash point: -49°C (-56°F)
Density (g/mL): 0.626; Refractive Index: 1.358
Catalog Number:
(TCC0304-25G)
Supplier:
TCI America
Description:
CAS Number: 98-15-7
MDL Number: MFCD00000594 Molecular Formula: C7H4ClF3 Molecular Weight: 180.55 Purity/Analysis Method: >90.0% (GC) Form: Clear Liquid Boiling point (°C): 139 Flash Point (°C): 36 Specific Gravity (20/20): 1.35
Supplier:
Bachem Americas
Description:
Also known as dioxopiperazines, piperazine-2,5-diones or DKPs. Diketopiperazines may occur as by-products during peptide synthesis or during the degradation of peptides. These cyclic dipeptides have been detected as taste-modulating compounds in food, they often show biological activity. DKPs are valuable chiral synthons, employed e.g. in Schöllkopf's versatile bislactim ether approach. They also have found use as catalysts for enantioselective synthesis, e.g. in the asymmetric Strecker reaction. See also the TRH metabolite cyclo(-His-Pro), G-1745, and cyclo(-Asp-Phe), G-1695, the major degradation product of aspartame.
Catalog Number:
(10796-206)
Supplier:
Brady Worldwide
Description:
Secure storage with locking handle (2 keys included)
Supplier:
Anaspec Inc
Description:
Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 MW: 4181.8 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
BeanTown Chemical
Description:
CAS: 109-97-7; EC No: 203-724-7; MDL No: MFCD00005216; RTECS: UX9275000
UN No: UN1992; Haz Class: 3 (6.1); Packing Group: III
Liquid; Molecular Formula: C4H5N; MW: 67.09
Melting Point: -23°; Boiling Point: 131°; Flash point: 36°C (97°F)
Density (g/mL): 0.967; Refractive Index: 1.508
Air Sensitive, Light Sensitive, Moisture Sensitive
Catalog Number:
(77685-333)
Supplier:
AMBEED, INC
Description:
2-(2-Bromophenyl)piperazine ≥95%
Catalog Number:
(ALA129567250MG)
Supplier:
ALADDIN SCIENTIFIC
Description:
Azaguanine-8 is a purine analogs showing antineoplastic activity by competing with guanine in the metabolism.A triazolo guanine analog that inhibits purine nucleotide biosynthesis.
Supplier:
Spectrum Chemicals
Description:
DL-Leucic Acid, Purity: 98.0 %, Cas number: 10303-64-7, Molecular formula: C6H12O3, Molecular Weight: 132.16, Color/Appearance: White, Off-white, Crystals, Powder, Synonyms: 2-Hydroxy-4-methylvaleric Acid, Size: 25G
Supplier:
ALADDIN SCIENTIFIC
Description:
H-Pro-Tyr-OH
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
