Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Fmoc-2-amino-2-indancarboxylic+acid


157,560  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"157560"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10115-212)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: Ryk antibody was raised against a 13 amino acid peptide near the internal region of Ryk (mouse); Applications: ELISA,Western blotting
Catalog Number: (10072-166)

Supplier:  Prosci
Description:   MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells and exerts HIV suppressive activity. The 67 amino acid form of MDC displays reduced chemoattractant activity but retains HIV suppressive activity. Recombinant human MDC is an 8.0 kDa protein containing 67 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines.
Catalog Number: (103008-568)

Supplier:  Anaspec Inc
Description:   This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: (76202-246)

Supplier:  Enzo Life Sciences
Description:   Produced in CHO cells. Contains 112/224 amino acids.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the Influenza A virus (A/Babol/36/2005 (H3N2)) neuraminidase (ACN50232.1) (His 36-Pro 459) was expressed, the cell lysates are collected, and bio-activity was tested. There is an amino acid change from Arginine to Lysine (R292K mutation) in NA / Neuraminidase.
Supplier:  MilliporeSigma
Description:   L-3,3'',5-Triiodothyronine, Free Acid, High Purity. (T3). Beige solid. PROTECT FROM LIGHT. Chromatographically purified. Purity: >= 99% by HPLC. Soluble in 100 mM NaOH. RTECS AY6750000, CAS 6893-02-3, M.W. 651.0.
MSDS SDS
Supplier:  Matrix Scientific
Description:   4-Nitro-L-phenylalanine monohydrate 95
Catalog Number: (10113-814)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: Muc5b antibody was raised against a 14 amino acid synthetic peptide near the internal region of Muc5b (mouse), Tested Applications: ELISA, WB

Supplier:  Bioss
Description:   The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319 amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213 amino acid extracellular region, a single transmembrane domain, and a 62 amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   (1S,4R)-N-Boc-1-aminocyclopent-2-ene-4-carboxylic acid 95%, 98% ee
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> Non-glycosylated protein, containing 145 amino acids.
Supplier:  Bachem Americas
Description:   Sequence: H-p-Bz-Phe-OH
Supplier:  AMBEED, INC
Description:   (H-Homocys-OH)â‚‚ 95%
New Product
Catalog Number: (10114-350)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: Bbs1 antibody was raised against a 15 amino acid synthetic peptide near the internal region of Bbs1 (mouse); Applications: ELISA
Supplier:  Macherey-Nagel
Description:   These glass plates with a special layer are used for TLC enantiomer separations (e.g. amino acids, thiazolidine derivatives, dipeptides, lactones, α-hydroxycarboxylic acids).
Small Business Enterprise

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 026675-500MG , MDL Number: MFCD03773330
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,329 - 7,344  of 157,560