Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Gal[236Bn]beta(1-4)Glc[236Bn]-beta-MP


33,994  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   The ARNT / HIF-1 beta Antibody (H1beta234) [Alexa Fluor« 647] from Novus Biologicals is a mouse monoclonal antibody to ARNT / HIF-1 beta. This antibody reacts with human, mouse, rat, bovine, ferret, primate, sheep. The ARNT / HIF-1 beta Antibody (H1beta234) [Alexa Fluor« 647] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039842-500MG , MDL Number: MFCD01690343
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal (1B12) antibody to beta Tubulin for WB, ICC/IF and IHC with samples derived from Human, Monkey, Rat and Mouse.
Supplier:  Anaspec Inc
Description:   This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  AFG BIOSCIENCE LLC
Description:   Rat HSPb2 (Heat Shock Protein Beta 2) ELISA Kit

Supplier:  Bioss
Description:   Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is involved in adhesive interactions of leukocytes. It is a receptor for fibronectin and recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Integrin alpha-4/beta-7 is also a receptor for MADCAM1 and VCAM1. It recognizes the sequence L-D-T in MADCAM1. Integrin alpha-E/beta-7 is a receptor for E-cadherin.
Catalog Number: (89337-322)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta Tubulin (tubulin, beta)
Catalog Number: (89321-072)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to beta 2 Microglobulin (beta-2-microglobulin)

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Chorionic Gonadotrophin beta(beta-CG) ELISA Kit

Supplier:  Sino Biological
Description:   This antibody was obtained from a rabbit immunized with purified, recombinant Rat IL-1 beta (Catalog#80023-RNAE; Q63264-1; Val117-Ser268).
Supplier:  Boster Biological Technology
Description:   Mouse IgG monoclonal antibody for Spectrin(alpha and beta), spectrin, alpha, erythrocytic 1 (elliptocytosis 2); spectrin, beta, erythrocytic (SPTA1; SPTB ) detection. Tested with WB in Human. No cross reactivity with other proteins.
Supplier:  Bon Opus Biosciences
Description:   Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier:  ANTIBODIES.COM LLC
Description:   Goat polyclonal antibody to beta Catenin for ELISA, WB, IHC and IF with samples derived from Human.
Catalog Number: (103638-830)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human IL1B / IL-1B / IL-1 beta (rh IL1B / IL-1B / IL-1 beta; Catalog#10139-HNAE; NP_000567.1; Ala117-Ser269). IL1B / IL-1B / IL-1 beta specific IgG was purified by Human IL1B / IL-1B / IL-1 beta affinity chromatography.
Supplier:  Genetex
Description:   Mouse Monoclonal antibody to 17-Beta-Estradiol Clone: 4S112 (BGN/06/88112) Tested Applications: ELISA Pkg Size: 200 ug

Supplier:  Novus Biologicals
Description:   The Recombinant Human TGF-beta 1 Protein from Novus Biologicals is derived from E. coli. The Recombinant Human TGF-beta 1 Protein has been validated for the following applications: SDS-Page.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,097 - 2,112  of 33,994