Hafnium+(IV)+acetylacetonate
Supplier:
AMBEED, INC
Description:
2-Chloro-5-(2-phenyl-4-(pyridin-4-yl)-1H-imidazol-5-yl)phenol, Purity: 98+%, CAS Number: 303727-31-3, Appearance: White to pale-yellow powder or crystals, Storage: Sealed in dry, 2-8C, Size: 50MG
Catalog Number:
(10282-604)
Supplier:
Bioss
Description:
Apolipoproteins are protein components of plasma lipoproteins (1). The apolipoprotein C gene family encodes four homologous proteins designated apoC-I to -IV, which specifically modulate the metabolism of triglyceride-rich lipoproteins (2). The human apoC-I gene maps to chromosome 19q13.2 and is expressed primarily in the liver where it is activated when monocytes differentiate into macrophages (3,4). The human apoC-II gene maps to chromosome 19q13.2 and encodes a 79 amino acid single chain protein that is a necessary cofactor for the activation of lipoprotein lipase, the enzyme that hydrolyzes triglycerides in plasma and transfers the fatty acids to tissues (5–7). The human apoC-III gene maps to chromosome 11q23 and encodes a protein that may delay catabolism of triglyceride-rich particles by inhibiting lipoprotein lipase and hepatic lipase (8). The human apoC-IV gene maps to chromosome 19q13.2 and encodes a 127 amino acid protein that is primarily expressed in the liver (9,10).
Catalog Number:
(10282-602)
Supplier:
Bioss
Description:
Apolipoproteins are protein components of plasma lipoproteins (1). The apolipoprotein C gene family encodes four homologous proteins designated apoC-I to -IV, which specifically modulate the metabolism of triglyceride-rich lipoproteins (2). The human apoC-I gene maps to chromosome 19q13.2 and is expressed primarily in the liver where it is activated when monocytes differentiate into macrophages (3,4). The human apoC-II gene maps to chromosome 19q13.2 and encodes a 79 amino acid single chain protein that is a necessary cofactor for the activation of lipoprotein lipase, the enzyme that hydrolyzes triglycerides in plasma and transfers the fatty acids to tissues (5–7). The human apoC-III gene maps to chromosome 11q23 and encodes a protein that may delay catabolism of triglyceride-rich particles by inhibiting lipoprotein lipase and hepatic lipase (8). The human apoC-IV gene maps to chromosome 19q13.2 and encodes a 127 amino acid protein that is primarily expressed in the liver (9,10).
Catalog Number:
(10282-610)
Supplier:
Bioss
Description:
Apolipoproteins are protein components of plasma lipoproteins (1). The apolipoprotein C gene family encodes four homologous proteins designated apoC-I to -IV, which specifically modulate the metabolism of triglyceride-rich lipoproteins (2). The human apoC-I gene maps to chromosome 19q13.2 and is expressed primarily in the liver where it is activated when monocytes differentiate into macrophages (3,4). The human apoC-II gene maps to chromosome 19q13.2 and encodes a 79 amino acid single chain protein that is a necessary cofactor for the activation of lipoprotein lipase, the enzyme that hydrolyzes triglycerides in plasma and transfers the fatty acids to tissues (5–7). The human apoC-III gene maps to chromosome 11q23 and encodes a protein that may delay catabolism of triglyceride-rich particles by inhibiting lipoprotein lipase and hepatic lipase (8). The human apoC-IV gene maps to chromosome 19q13.2 and encodes a 127 amino acid protein that is primarily expressed in the liver (9,10).
Catalog Number:
(103620-670)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human ERBB2 (NP_004439.2) (Pro489-Cys630) was expressed with a polyhistidine tag at the C-terminus.
Supplier:
TCI America
Description:
CAS Number: 163931-61-1
MDL Number: MFCD00274218 Molecular Formula: C34H51F2NSi Molecular Weight: 539.87 Purity/Analysis Method: >97.0% (T) Form: Crystal Color: White Melting point (°C): 156
Catalog Number:
(10391-274)
Supplier:
Bioss
Description:
The hexokinases utilize Mg-ATP as a phosphoryl donor to catalyze the first step of intracellular glucose metabolism, the conversion of glucose to glucose-6-phosphate. Four hexokinase isoenzymes have been identified, including hexokinase I (HXK I), hexokinase II (HXK II), hexokinase III (HXK III) and hexokinase IV (HXK IV, also designated glucokinase or GCK). Hexokinases I-III each contain an N-terminal cluster of hydrophobic amino acids. Glucokinase lacks the N-terminal hydrophobic cluster. The hydrophobic cluster is thought to be necessary for membrane binding. This is substantiated by the finding that glucokinase has lower affinity for glucose than do the other hexokinases. HXK I has been shown to be expressed in brain, kidney and heart tissues as well as in hepatoma cell lines. HXK II is involved in the uptake and utilization of glucose by adipose and skeletal tissues. Of the hexokinases, HXK III has the highest affinity for glucose. Glucokinase is expressed in pancreatic beta cells where it functions as a glucose sensor, determining the “set point†for insulin secretion.
Supplier:
Healthcare Products
Description:
Breathable dressing is impermeable to liquids, bacteria, and viruses.
Supplier:
Strem Chemicals Inc
Description:
CAS #: 7791-23-3. Size: 5g.
Catalog Number:
(103008-696)
Supplier:
Anaspec Inc
Description:
GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 3089.5 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(TCA0576-025G)
Supplier:
TCI America
Description:
CAS Number: 554-73-4
MDL Number: MFCD00038130
Molecular Formula: C18H15N3O3S
Molecular Weight: 375.38
Form: Crystal
Color: Yellow
Catalog Number:
(80089-828)
Supplier:
Baxter
Description:
Solutions for irrigation (for Preparation of Slushed Solution)
Catalog Number:
(76471-812)
Supplier:
TrippNT
Description:
TrippNT's Valor crash cart is constructed from durable corrossion-resistant polymers to keep supplies secure and protected at all times.
Catalog Number:
(10241-088)
Supplier:
Bioss
Description:
PADI4 (peptidyl arginine deiminase, type IV) catalyzes the deimination of arginine residues of proteins. Down-regulates histone H3 and H4 arginine methylation, both by preventing arginine methylation by CARM1 and HRMT1L2/PRMT1 and by converting methylarginine to citrulline. subcellular location at cytoplasmic granules. Belongs to the protein arginine deiminase family. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.
Catalog Number:
(10403-614)
Supplier:
Bioss
Description:
May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Supplier:
TCI America
Description:
CAS Number: 1270-98-0
Molecular Formula: C5H5Cl3Ti Molecular Weight: 219.31 Purity/Analysis Method: >98.0% (T) Form: Crystal Melting point (°C): 210
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||