Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

L-Tyrosine+amide


13,916  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"13916"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Bachem Americas
Description:   PAR peptides (TRAP peptides and thrombin receptor-like peptides) activate the proteinase-activated receptors PAR-1 to PAR-4.
Supplier:  Bachem Americas
Description:   For the long-acting GLP-1 analog liraglutide see H-6724.
Supplier:  Bachem Americas
Description:   For the long-acting GLP-1 analog liraglutide see H-6724.
Catalog Number: (103008-696)

Supplier:  Anaspec Inc
Description:   GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Bachem Americas
Description:   The porcine homolog of gastric inhibitory polypeptide (6-30) amide (human) also known as glucose-dependent insulinotropic polypeptide (6-30) amide (human) has been found to antagonize the induction of cAMP production of gastric inhibitory polypeptide (human) (GIP (human)) (H-5645) in vitro. In competitive binding studies it has been shown to exhibit receptor binding affinity equivalent to the gastric inhibitory polypeptide (human) (ICâ‚…â‚€ = 3.08 ± 0.57 nM).
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041079-250MG , MDL Number: MFCD12028524
Supplier:  Thermo Scientific Chemicals
Description:   White to off-white
MSDS SDS
Supplier:  AMBEED, INC
Description:   Sodium acetyl((4-aminophenyl)sulfonyl)amide hydrate, Purity: 99%, CAS Number: 6209-17-2, Appearance: Form: solid Colour: off-white to yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100MG
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   L(+)-Asparagine 99%

Supplier:  LGC STANDARDS
Description:   N-Deethylcyanazine amide, TRC, LGC Standards
New Product
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Eltrombopag Amide
New Product
Supplier:  Bachem Americas
Description:   PAR peptides (TRAP peptides and thrombin receptor-like peptides) activate the proteinase-activated receptors PAR-1 to PAR-4.
Supplier:  Tosoh Bioscience
Description:   TSK-Gel® Amide-80 are stainless steel columns with non-ionic carbamoyl [-C(NHâ‚‚)O] groups on a silica gel basis.
Catalog Number: (H-6338.0500BA)

Supplier:  Bachem Americas
Description:   FNAPFDVGIKLSGAQYQQHGRAL-amide corresponds also to the sequence of mouse obestatin.
Supplier:  AMBEED, INC
Description:   N-Methyl-N,N-dioctyloctan-1-aminium bis((trifluoromethyl)sulfonyl)amide, Purity: 98%, CAS Number: 375395-33-8, Appearance: Colorless to Yellow Viscous Liquid, Storage: Inert atmosphere, Room Temperature, Size: 100g
Catalog Number: (700007-776)

Supplier:  Spectrum Chemicals
Description:   Stearic Acid Amide is used as a cosmetic foam boosting, opacifying and viscosity control agent.
Small Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
209 - 224  of 13,916
Prev   14  15  16  17  18  19  20  21  22  23  24  25  26  27  28  29  Next