Text Search >
L-Tyrosine+amide
Print…
You Searched For:
13,766 results were found
L-Tyrosine+amide
Supplier:
Hichrom
Description:
Avantor® ACE® UltraCore Biphenyl are high performing solid-core (core-shell) particle columns, designed for a range of chromatographic applications and is especially well suited for retention of aromatic compounds that elute early on alkyl phases.
Supplier:
Anaspec Inc
Description:
This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 4469.8 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
Bachem Americas
Description:
1mg CAS: 53697-27-1 C75H107N21O18S FW: 1622.87 . Synonym: ACTH (1-13) amide
Supplier:
BeanTown Chemical
Description:
CAS: 98-92-0; EC No: 202-713-4; MDL No: MFCD00006395; RTECS: QS3675000
Powder; Molecular Formula: C6H6N2O; MW: 122.13
Melting Point: 128-132°; Flash point: 150°C (302°F)
Density (g/mL): 1.4
Catalog Number:
(TS46560-0050)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Sulfamethazine sodium salt
Catalog Number:
(H-5848.0025BA)
Supplier:
Bachem Americas
Description:
Selective agonist of PAR-1.
Sequence: H-Thr-Phe-Leu-Leu-Arg-NH2 Salt: Trifluoroacetate
Supplier:
AMBEED, INC
Description:
1-Methyl-N-(2-methyl-4-(o-tolyldiazenyl)phenyl)-1H-pyrazole-5-carboxamide, Purity: 98%, CAS Number: 301326-22-7, Appearance: Solid, Storage: Sealed in dry, 2-8 C, Size: 10mg
Catalog Number:
(95053-544)
Supplier:
Enzo Life Sciences
Description:
Glucagon-like peptide-1 (9-36) amide and GLP-1 (9-37) are the forms of GLP-1 which result from rapid degradation of the active forms of the peptide (GLP-1 (7-36) amide and GLP-1 (7-37)) by the enzyme dipeptidyl peptidase-IV (DPP-IV, also known as CD26 or adenosine deaminase binding protein). GLP-1 is a peptide hormone of the glucagon family, produced by the L cells of the intestinal mucosa from the same prohormone as glucagon. The active forms are potent stimulators of glucose-dependent insulin secretion. The sequence of GLP-1 is fully conserved in all mammalian species examined so far.
Catalog Number:
(103006-660)
Supplier:
Anaspec Inc
Description:
This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2 MW: 1773 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Catalog Number:
(76079-732)
Supplier:
Bioss
Description:
Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Catalog Number:
(102996-380)
Supplier:
Anaspec Inc
Description:
This GLP-1 (7-36) amide, is labeled with biotin at the peptide N-terminus. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 3524 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
APOLLO SCIENTIFIC
Description:
Lithium bis(trifluoromethylsulfonyl)imide 99%
Supplier:
AMBEED, INC
Description:
(S)-2-Amino-2-phenylacetamide, Purity: 97%, CAS Number: 6485-52-5, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 10G
Catalog Number:
(102876-304)
Supplier:
R&D Systems
Description:
The Recombinant Human PAM Protein from R&D Systems is derived from NS0. The Recombinant Human PAM Protein has been validated for the following applications: Enzyme Activity.
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 056883-250G , MDL Number: MFCD00007981
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
