Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

L-Tyrosine+amide


13,182  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"13182"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Strem Chemicals Inc
Description:   CYPHOS IL, Ionic Liquids, Phosphine

Supplier:  AAT BIOQUEST INC
Description:   Alkyne Modifier II, NHS ester is an alkyne-containing reagent that reacts with primary amines at pH 7 to 9 forming a stale amide bond.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  Anaspec Inc
Description:   In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4111.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (G-4185.0250BA)

Supplier:  Bachem Americas
Description:   The dipeptide His-Pro-amide represents the initial enzymatic degradation product of TRH in plasma. CAS Number (net): 33605-69-5.

Supplier:  Prosci
Description:   Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides
Supplier:  Invitrogen
Description:   Carboxyl groups, in the form of carboxy termini, aspartate residues or glutamate residues, can be targeted for biotin labeling using amine-derivatized biotin molecules. This reaction is mediated by a class of crosslinkers known as carbodiimides and results in the formation of an amide bond. The reaction with EDC, the most common carbodiimide crosslinker, is generally performed in an MES buffer at pH 4.5 - 5 and requires just minutes to complete.
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 7341-96-0; MDL No: MFCD04035573 Solid; Linear Formula: HC≡CCONH2; Molecular Formula: C3H3NO; MW: 69.06 Melting Point: 57-62°
MSDS SDS
Supplier:  Bachem Americas
Description:   A molluscan neuropeptide isolated from the ganglia of Macrocallista nimbosa. FMRF-amide seems to be involved in neuronal NO production in gastropoda. CAS Number (net): 64190-70-1.
Catalog Number: (103007-796)

Supplier:  Anaspec Inc
Description:   This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2
MW:2016.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Bachem Americas
Description:   The dipeptide Arg-Phe mimics the haemodynamic effects of FMRF amide. Both peptides increased blood pressure and heart rate in anaesthesized rats by central stimulation of the sympathetic nervous system, RF being approximately 4 fold more potent.
Supplier:  AOB CHEM USA
Description:   3-Iodo-2-(2,2,2-trimethylacetamido)pyridine ≥95% research grade
Supplier:  AMBEED, INC
Description:   (R)-2-Aminosuccinamic acid hydrate, Purity: 97%, CAS Number: 5794-24-1, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 25g
Supplier:  Thermo Scientific Chemicals
Description:   CAS No.: 75921-69-6
Molecular Formula: C78H111N21O19
Formula Weight: 1647.00
Storage Temperature: -30°C to -10°C
Physical Form: Solid
Appearance: White to off-white
MDL No.: MFCD00151715
Supplier:  Biotium
Description:   5(6)-FAM SE (full name: 5-(and-6)-Carboxyfluorescein, succinimidyl ester mixed isomers) is an amine-reactive green fluorescent dye widely used for labeling proteins or other molecules that contain a primary or secondary aliphatic amine. The coupling reaction is usually carried out at pH 8-9.5. The amide linkage from the coupling reaction is much more stable than the thiourea linkage formed from the coupling of an amine and an isothiocyanate.
Catalog Number: (103007-322)

Supplier:  Anaspec Inc
Description:   This hexapeptide, acetylated on the amino terminus and amidated on the carboxyl terminus, inhibits the specific binding of 125I-IL-8 to neutrophils. IL-8 is a member of the chemokine alpha subfamily that activates neutrophils and is chemotactic for these cells. IL-8 Inhibitor also suppresses the binding of macrophage inflammatory protein 2 (MIP 2) beta to neutrophils.
Sequence:Ac-RRWWCR-NH2
MW:1003.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Bachem Americas
Description:   Besides deltorphins, dermorphins, dynorphins, enkephalins and endorphins, Bachem offers opioid peptides such as acetalins, BAM peptides, α-casein and gluten exorphins, endomorphins, kyotorphins, metorphamide, opiorphins, δ opioid receptor antagonists, and valorphin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
529 - 544  of 13,182
Prev   34  35  36  37  38  39  40  41  42  43  44  45  46  47  48  49  Next