Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

L-Tyrosine+amide


13,864  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"13864"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C9H9FN4O5 MW=272.19 CAS=95713-52-3 MDL=MFCD00042049 1G
Supplier:  AMBEED, INC
Description:   4-Methoxybenzamide 97%

Supplier:  Bioss
Description:   Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Supplier:  Bioss
Description:   Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Supplier:  Anaspec Inc
Description:   GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Thermo Scientific Chemicals
Description:   97%
MSDS SDS
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Olanzapine EP Impurity B (Olanzapine Amide)
New Product
Supplier:  AMBEED, INC
Description:   Molsidomine 98%
Supplier:  Honeywell Research Chemicals
Description:   ACS GENERAL USE SOLVENTS
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Biuret 97%, Extra Pure
Catalog Number: (102550-994)

Supplier:  Matrix Scientific
Description:   4-CHLORO-PYRIDINE-2-CARBOXYLIC ACID AMIDE MF=C6H5CLN2O MW=156.57 CAS=99586-65-9 MDL=MFCD01085339
Supplier:  TCI America
Description:   CAS Number: 1068-21-9
MDL Number: MFCD00015676
Molecular Formula: C4H12NO3P
Molecular Weight: 153.12
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 140
Melting point (°C): 52
Flash Point (°C): 110
MSDS SDS
Supplier:  Diagnostic Biosystems
Description:   The antibody is specific against gastrin-containing cells. This anti-body reacts with human gastrin I and human gastrin I fragments. No cross-reactivity was observed with rat gastrin, human big gastrin, human gastrin releasing peptide, sulfated cholecystokinin amide, non-sulfated cholecystokinin amide and cholecystokinin.
Supplier:  AMBEED, INC
Description:   Bisacrylamide 97%
New Product
Supplier:  Matrix Scientific
Description:   MF=C10H15F3N2O3 MW=268.24 ,250Mg
Supplier:  TCI America
Description:   CAS Number: 3130-87-8
MDL Number: MFCD00151039
Molecular Formula: C4H8N2O3
Molecular Weight: 132.12
Purity/Analysis Method: >99.0% (T)
Form: Crystal
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
465 - 480  of 13,864
Prev   30  31  32  33  34  35  36  37  38  39  40  41  42  43  44  45  Next