Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
 
SearchResultCount:"13864"
Searching List View List View BETA(new) 
Sort by:
 
 
 
 

Image Unavailable
Description:   Matrix Scientific Part Number: 057111-50G , MDL Number: MFCD00017120
Catalog Number: 101912-416
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Image Unavailable
Description:   This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.
Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
MW:2155.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-472
Supplier: Anaspec Inc



Quantity:
 
 
 
   
Image Unavailable
Description:   The Recombinant Human PAM Protein from R&D Systems is derived from NS0. The Recombinant Human PAM Protein has been validated for the following applications: Enzyme Activity.
Catalog Number: 102876-304
Supplier: R&D Systems



Quantity:
 
 
 
   
Image Unavailable
Description:   Temporin A is a highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria. This antimicrobial peptide exerts its effect by inducing the migration of human monocytes, macrophages, and neutrophils, thus modulating the permeability of the microbial membrane to allow passage of various-sized molecules and exhibiting activity against gram-positive bacteria, particularly antibiotic-resistant gram-positive cocci. Temporin A activity is enhanced when used in combination with other antimicrobial agents.
Sequence:FLPLIGRVLSGIL-NH2
MW:1396.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-474
Supplier: Anaspec Inc



Quantity:
 
 
 
   
Image Unavailable
Description:   4-Methoxybenzamide 97%
Catalog Number: 76688-180
Supplier: AMBEED, INC



Quantity:
 
 
 
   
Image Unavailable
Description:   Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Catalog Number: 10408-536
Supplier: Bioss



Quantity:
 
 
 
   
Image Unavailable
Description:   Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Catalog Number: 10408-540
Supplier: Bioss



Quantity:
 
 
 
   
Image Unavailable
Description:   GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 102999-330
Supplier: Anaspec Inc



Quantity:
 
 
 
   
Product Image
Description:   MF=C10H15F3N2O3 MW=268.24 ,250Mg
Catalog Number: 101934-276
Supplier: Matrix Scientific



Quantity:
 
 
 
   
Image Unavailable
Description:   Pharmaceutical Standards, Olanzapine EP Impurity B (Olanzapine Amide)
Catalog Number: 77458-516
Supplier: TLC PHARMACEUTICAL STANDARD LTD


New Product

Quantity:
 
 
 
   
Image Unavailable
Description:   Benzyl(ethyl)dimethylammonium Bis(trifluoromethanesulfonyl)imide, Purity: >98.0%(HPLC)(T), CAS Number: 1186103-43-4, Molecular Formula: C13H18F6N2O4S2, Molecular Weight: 444.41, Size: 5G
Catalog Number: TCB5427-5G
Supplier: TCI America



Quantity:
 
 
 
   
Image Unavailable
Description:   97%
Catalog Number: AAA13141-22
Supplier: Thermo Scientific Chemicals



Quantity:
 
 
 
MSDS SDS Certificate Certificates    
Image Unavailable
Description:   CAS Number: 1068-21-9
MDL Number: MFCD00015676
Molecular Formula: C4H12NO3P
Molecular Weight: 153.12
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 140
Melting point (°C): 52
Flash Point (°C): 110
Catalog Number: TCD2361-5G
Supplier: TCI America



Quantity:
 
 
 
MSDS SDS Certificate Certificates    
Image Unavailable
Description:   The antibody is specific against gastrin-containing cells. This anti-body reacts with human gastrin I and human gastrin I fragments. No cross-reactivity was observed with rat gastrin, human big gastrin, human gastrin releasing peptide, sulfated cholecystokinin amide, non-sulfated cholecystokinin amide and cholecystokinin.
Catalog Number: 76635-030
Supplier: Diagnostic Biosystems



Quantity:
 
 
 
   
Image Unavailable
Description:   Bisacrylamide 97%
Catalog Number: 76729-238
Supplier: AMBEED, INC


New Product

Quantity:
 
 
 
   
Image Unavailable
Description:   CAS Number: 3130-87-8
MDL Number: MFCD00151039
Molecular Formula: C4H8N2O3
Molecular Weight: 132.12
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Catalog Number: TCA0541-025G
Supplier: TCI America



Quantity:
 
 
 
MSDS SDS Certificate Certificates    
Items Per Page: 16  32  64 
1 - 16  of 13,864
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next