Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
This carefully selected portfolio is specifically designed to help you prevent potential contamination and maintain aseptic conditions in cleanrooms and controlled environments...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
Description:
This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure. Sequence:RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13) MW:2155.7 Da % peak area by HPLC:95 Storage condition:-20° C
Description:
The Recombinant Human PAM Protein from R&D Systems is derived from NS0. The Recombinant Human PAM Protein has been validated for the following applications: Enzyme Activity.
Description:
Temporin A is a highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria. This antimicrobial peptide exerts its effect by inducing the migration of human monocytes, macrophages, and neutrophils, thus modulating the permeability of the microbial membrane to allow passage of various-sized molecules and exhibiting activity against gram-positive bacteria, particularly antibiotic-resistant gram-positive cocci. Temporin A activity is enhanced when used in combination with other antimicrobial agents. Sequence:FLPLIGRVLSGIL-NH2 MW:1396.8 Da % peak area by HPLC:95 Storage condition:-20° C
Description:
Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Description:
Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates.
Description:
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation. Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 3297.7 Da % Peak area by HPLC: 95 Storage condition: -20° C
Description:
The antibody is specific against gastrin-containing cells. This anti-body reacts with human gastrin I and human gastrin I fragments. No cross-reactivity was observed with rat gastrin, human big gastrin, human gastrin releasing peptide, sulfated cholecystokinin amide, non-sulfated cholecystokinin amide and cholecystokinin.