L-Tyrosine+amide
Supplier:
TCI America
Description:
CAS Number: 124-26-5
MDL Number: MFCD00008038 Molecular Formula: C18H37NO Molecular Weight: 283.50 Purity/Analysis Method: >90.0% (GC) Form: Crystal Color: White Melting point (°C): 109 Flash Point (°C): 197
Catalog Number:
(10073-068)
Supplier:
Prosci
Description:
Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides
Catalog Number:
(H-3018.0500BA)
Supplier:
Bachem Americas
Description:
The N-terminus of dynorphin, YGGFL, corresponds to Leu-enkephalin. So, dynorphin A (1-5) amide is filed as Leu-enkephalin amide (H-2745). For other opioid peptides see, the product families ‘Deltorphins and Dermorphins’, ‘Endorphins, MPF, Neoendorphins’, and ‘Opioid Peptides'.
Supplier:
Enzo Life Sciences
Description:
TRPV1 agonist
Catalog Number:
(10408-922)
Supplier:
Bioss
Description:
This gene encodes a fatty acid amide hydrolase that shares a conserved protein motif with the amidase signature family of enzymes. The encoded enzyme is able to catalyze the hydrolysis of a broad range of bioactive lipids, including those from the three main classes of fatty acid amides; N-acylethanolamines, fatty acid primary amides and N-acyl amino acids. This enzyme has a preference for monounsaturated acyl chains as a substrate.[provided by RefSeq, Sep 2009]
Catalog Number:
(77881-209)
Supplier:
AMBEED, INC
Description:
Isonicotinamide 98%
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
4-Methoxybenzamide 97%
Supplier:
Bachem Americas
Description:
For Fmoc solid phase synthesis of N-alkyl peptide amides by reductive amination.
Supplier:
Anaspec Inc
Description:
This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 4469.8 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(77402-308)
Supplier:
APOLLO SCIENTIFIC
Description:
Isonicotinamide 99%
Supplier:
MP Biomedicals
Description:
Storage: Store at Room Temperature (15-30 °C)
L-Glutamine, the uncharged and amidated analog of L-glutamic acid, is an important amino acid for the incorporation of NH4+ into biomolecules. It is biosynthesized from NH4. L-Glutamine is an essential amino acid that is a crucial component of culture media that serves as a major energy source for cells in culture. L-Glutamine is an essential amino acid that is a crucial component of culture media that serves as a major energy source for cells in culture. L-Glutamine is very stable as a dry powder and as a frozen solution. In liquid media or stock solutions, however, L-glutamine degrades relatively rapidly. Optimal cell performance usually requires supplementation of the media with L-glutamine prior to use.
Catalog Number:
(10108-664)
Supplier:
Prosci
Description:
CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia.Carboxylesterase 1 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia. Three transcript variants encoding three different isoforms have been found for this gene.
Catalog Number:
(10688-944)
Supplier:
Abnova
Description:
Goat polyclonal antibody raised against synthetic peptide of AMID.
Catalog Number:
(TCM1660-5G)
Supplier:
TCI America
Description:
CAS Number: 375395-33-8
Molecular Formula: C27H54F6N2O4S2 Molecular Weight: 648.85 Purity/Analysis Method: >98.0% (N) Form: Clear Liquid Melting point (°C): -75 Specific Gravity (20/20): 1.11
Supplier:
Bachem Americas
Description:
Human IAPP (8-37), ATQRLANFLVHSSNNFGAILSSTNVGSNTY-amide, readily forms fibrils in vitro.
Supplier:
ALADDIN SCIENTIFIC
Description:
It is a tertiary amide having bulky N-groups. Its reduction to the corresponding amine, by reaction with silane in the presence of MoO2Cl2 (catalyst), has been reported.. Reactant for preparation of triazolothiadiazepine dioxide derivatives . Reactant for preparation of halo-substituted aromatic amides . Reactant for preparation of [[(phenyl)piperazinyl]alkyl]indolyl]ethanone and [[[(phenoxyethyl)piperazinyl]alkyl]indolyl]ethanone derivatives as α1-adrenoreceptor antagonists . Reactant for synthesis of naphthalenedione derivatives as antimycobacterial agents . Reactant for regioselective ortho Suzuki-Miyaura coupling reaction It may be used in the synthesis of 5-chloroindole.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||