Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

L-Tyrosine+amide


13,182  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"13182"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103008-238)

Supplier:  Anaspec Inc
Description:   This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: (100272-910)

Supplier:  Indofine Chemical Company
Description:   Rare Organics & BioChemicals 64205-12-5 5gm Z-D-Tyr-OH.2H2O 351.4 Room temperature.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041951-1G , MDL Number: MFCD02682269
Supplier:  AMBEED, INC
Description:   FMOC-O-tert-butyl-L-tyrosine 98%
Supplier:  AMBEED, INC
Description:   L-Tyrosine benzyl ester-p-toluenesulfonate 98%
New Product
Supplier:  Thermo Scientific Chemicals
Description:   99%. 50g.
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 020549-25G , MDL Number: MFCD00002392
Supplier:  AMBEED, INC
Description:   L-Tyrosine ethyl ester hydrochloride 98%
New Product
Supplier:  Invitrogen
Description:   Thermo Scientific Pierce EDC is a carboxyl- and amine-reactive zero-length crosslinker. EDC reacts with a carboxyl group first and forms an amine-reactive O-acylisourea intermediate that quickly reacts with an amino group to form an amide bond with release of an isourea by-product. The intermediate is unstable in aqueous solutions and so two-step conjugation procedures rely on N-hydroxysuccinimide (NHS) for stabilization. Failure to react with an amine will result in hydrolysis of the intermediate, regeneration of the carboxyl, and release of an N-substituted urea. A side reaction is the formation of an N-acylurea, which is usually restricted to carboxyls located in hydrophobic regions of proteins.
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 71989-38-3
Molecular Formula: C28H29NO5
Molecular Weight: 459.54
Purity/Analysis Method: >98.0% (T,HPLC)
Form: Crystal
Melting point (°C): 153
Specific rotation [a]20/D: -30 deg (C=1, DMF)
Storage Temperature: 0-10°C
MSDS SDS
Catalog Number: (77317-426)

Supplier:  AMBEED, INC
Description:   2-Fluorobenzamide 95%
Supplier:  AMBEED, INC
Description:   Boc-L-M-Tyrosine, Purity: 98%, CAS Number: 90819-30-0, Appearance: White to off-white solid, Storage: Sealed in dry, 2-8 C, Size: 250mg
Supplier:  TCI America
Description:   CAS Number: 4332-95-0
MDL Number: MFCD00027415
Molecular Formula: C16H14N2O2S
Molecular Weight: 298.36
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 221
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: H-Tyr-OBzl
Supplier:  Bachem Americas
Description:   Sequence: H-Tyr(PO₃H₂)-OH
Supplier:  MP Biomedicals
Description:   Flavin Adenine Dinucleotide is a prosthetic group of certain oxidases.
Flavin adenine dinucleotide (FAD) is used as a redox cofactor (electron carrier) by flavoproteins including succinate dehydrogenase (complex), α-ketoglutarate dehydrogenase, apoptosis-inducing factor 2 (AIF-M2, AMID), folate/FAD-dependent tRNA methyltransferases, and N-hydroxylating flavoprotein monooxygenases. FAD is a component of the pyruvate dehydrogenase complex.
Store at -0 °C.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
817 - 832  of 13,182
Prev   52  53  54  55  56  57  58  59  60  61  62  63  64  65  66  67  Next