Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Methoxycyclohexanecarboxylic+acid


44,628  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"44628"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  MP Biomedicals
Description:   Amoxicillin is a moderate-spectrum, β-lactam antibiotic and antibacterial agent against gram-positive and gram-negative bacteria.
Catalog Number: (10115-252)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: SYT6 antibody was raised against a 13 amino acid peptide near the C Terminus of SYT6; Applications: ELISA,Western blotting
Catalog Number: (10112-652)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: FLNB antibody was raised against a 13 amino acid synthetic peptide near the internal region of FLNB, Application: ELISA
Catalog Number: (10112-118)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: Thrb antibody was raised against a 17 amino acid synthetic peptide near the internal region of Thrb, Application: ELISA
Supplier:  Bachem Americas
Description:   Sequence: H-3-Iodo-Tyr-OH
Supplier:  Bachem Americas
Description:   Human galanin, a 30-amino acid non-amidated peptide, has originally been isolated from colon and pituitary. Its sequence differs from that of rat and porcine galanins by 4 and 6 amino acids in the C-terminal moiety, respectively. Synthetic human galanin is equipotent to the rat peptide in the isolated rat fundus muscle strip bioassay. Both peptides also fully activate the rat galanin receptor, indicating the importance of the conserved N-terminal portion of galanin for receptor interaction. Galanin, which is widely distributed in the CNS, and GAL receptors (GALR) are overexpressed in limbic brain regions associated with cognition in Alzheimer disease. As galanin inhibits acetylcholine release, galanin antagonists have gained interest in AD research.
Catalog Number: (103003-054)

Supplier:  Anaspec Inc
Description:   This core region of human amylin, corresponding to amino acid residues 20 to 29, forms amyloid-like fibrils that display polymorphic structures.
Sequence: SNNFGAILSS
MW: 1009.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   N-(3,3-Dimethylindolin-6-yl)-2-((pyridin-4-ylmethyl)amino)nicotinamide diphosphate, Purity: 98%, CAS Number: 857876-30-3, Appearance: White solid, Storage: Inert atmosphere, Store in freezer, under -20 C, Size: 5mg

Supplier:  Anaspec Inc
Description:   This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   N2,Nd,Nw-tris(tert-butoxycarbonyl)-L-arginine 95%
Catalog Number: (10080-770)

Supplier:  Prosci
Description:   Polyclonal, Host: Rabbit, Species reacivity: human, Immunogen: Synthetic 15 amino acid peptide from cytoplasmic domain of human SLC39A14, Tested application: IHC
Catalog Number: (10072-172)

Supplier:  Prosci
Description:   HCC-1 is a CC chemokine that signals through the CCR1 receptor and chemoattracts blood monocytes. It is secreted by various tissues including skeletal muscle, heart, spleen, liver, bone marrow and plasma. Mature HCC-1 is found in four different forms, which are distinguished by differential N-terminal truncation and contain 74, 72, 71, or 66 amino acid residues. Recombinant human HCC-1 (66 a.a.) is a 7.8 kDa protein consisting of 66 amino acids including the four highly conserved residues present in CC chemokines.
Catalog Number: (77138-614)

Supplier:  AMBEED, INC
Description:   (1S,2S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)cyclopentanecarboxylic acid, Purity: 95%, CAS Number: 359586-64-4, Appearance: White to off-white powder or crystals, Storage: Sealed in dry, 2-8 deg C, Size: 250mg
Supplier:  AMBEED, INC
Description:   N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-2-phenylglycine 97%
Supplier:  AMBEED, INC
Description:   Nα-Fmoc-Nω-(p-toluenesulfonyl)-L-arginine 97%
Catalog Number: (ALA151515-5G)

Supplier:  ALADDIN SCIENTIFIC
Description:   3-Amino-5-phenylpyrazole ((3-phenyl-1H-pyrazol-5-amine) may be used in the synthesis of the following: · Urea derivatives by reaction with azido(6-(benzofuran-2-yl)-2-methylpyridin-3-yl) methanone. · 2-Mercaptoacetamide analogs by treating with thioglycolic acid. · 3-(Substituentpyrimidayl)-5,6-benzocoumarins by treating with 3-(2′-formyl-1′-chlorovinyl)-5,6-benzocoumarin. · Substituted 2,7-diphenylpyrazolo[1,5-a]pyrimidine-5-carboxylic esters by reacting with substituted β-diketo esters. · N-ethoxycarbonylthiourea derivative by reacting with ethoxycarbonyl isothiocyanate. · Heterobiaryl pyrazolo[3,4-b]pyridines by reacting with indole-3-carboxaldehyde.
New Product
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,177 - 2,192  of 44,628