Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

potassium+thiobenzoate


59,481  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"59481"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Prosci
Description:   Anti-Mouse Monoclonal Antibody [clone: 4967]
Supplier:  APOLLO SCIENTIFIC
Description:   2-Bromo-2,6-dichlorotoluene
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 058958-1G , MDL Number: MFCD00154706
Supplier:  AMBEED, INC
Description:   2-(6-Bromonaphthalen-2-yl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane ≥98%
New Product
Supplier:  SPEX CERTIPREP LLC
Description:   Single-Component organic standards.
Catalog Number: (77592-324)

Supplier:  AMBEED, INC
Description:   Amphotericin B ≥750 µg/mg
New Product
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Bromocresol green, pure indicator grade
Catalog Number: (100204-210)

Supplier:  Strem Chemicals Inc
Description:   CAS #: 7693-26-7. Size: 300g.
Supplier:  Matrix Scientific
Description:   MF=C9H8N2O MW=160.18 MDL=MFCD13179035 ,500Mg
Supplier:  Thermo Scientific Chemicals
Description:   Crystalline powder
MSDS SDS
Supplier:  AMBEED, INC
Description:   Sodium Dimethyl 5-sulfoisophthalate 98%
Supplier:  Bel-Art Products
Description:   Open, nickel plated brass armor protects thermometer from accidental breakage during use and storage.
Supplier:  APOLLO SCIENTIFIC
Description:   Coniferyl alcohol 98%

Supplier:  Ace Glass
Description:   Standard taper, hollow polyethylene stoppers with flat top.
Small Business Enterprise

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier:  Sino Biological
Description:   This product is a recombinant monoclonal antibody expressed from HEK293 cells.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,305 - 4,320  of 59,481