Text Search >
2,2\\\'-[ethylenebis(oxy)]bisacetic acid
Print…
You Searched For:
23,118 results were found
2,2\\\'-[ethylenebis(oxy)]bisacetic acid
Catalog Number:
(89367-420)
Supplier:
Genetex
Description:
Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, particularly amino-terminal region containing active site cysteine residue, and the thiolspecific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx6 belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx1, 2, and 6 in cytosol, Prx3 in mitochondria, Prx 4 in ER and secretion, Prx 5 showing complicated distribution including peroxisome, mitochondria and cytosol.
Catalog Number:
(RL000-001-M48)
Supplier:
Rockland Immunochemical
Description:
HIV tat protein Control Peptide
Supplier:
AMBEED, INC
Description:
Boc-2-chloro-D-phenylalanine 97%
Supplier:
Thermo Scientific Chemicals
Description:
Nonyl Beta-D-Glucopyranoside, Purity: 98%, CAS Number: 69984-73-2, Molecular Formula: C15H30O6, Form: Powder, Synonym: Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys (Disulfide bridge: Cys34-Cys43), Size: 1g
Catalog Number:
(RL610742124)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Supplier:
Thermo Scientific Chemicals
Description:
N-Fmoc-S-trityl-L-cysteine pentafluorophenyl ester, Purity: 98%, CAS Number: 115520-21-3, molecular formula: C43H30F5NO4S, Synonyms: Fmoc-Cys(Trt)-Opfp, 1g
Catalog Number:
(RL603145126)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Catalog Number:
(10001-892)
Supplier:
Biotium
Description:
Goat anti-human IgG, Fc gamma specific antibody reacts specifically with the human IgG heavy (γ) chains and not with light chains and F(ab’)2 fragment on all human immunoglobulins. To minimize cross-reactivity, it has been adsorbed against bovine, horse, mouse and rabbit serum proteins prior to conjugation. CF™640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CF™640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CF™640R is its exceptional photostability.
Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Catalog Number:
(RL603141126)
Supplier:
Rockland Immunochemical
Description:
Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates 100ug
Supplier:
Bachem Americas
Description:
Tertiapin (TPN), a potent inhibitor of the inward-rectifier K⁺ channels, blocked a G-protein-gated channel (GIRK1/4) and the ROMK1 channel with nanomolar affinities, however a closely related channel, IRK1, was insensitive to tertiapin. Thus, tertiapin will be a powerful ligand for purifying functional channels as well as for screening pharmaceutical agents against these channels.
Catalog Number:
(103007-636)
Supplier:
Anaspec Inc
Description:
Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV Molecular Weight: 4345.9 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10001-922)
Supplier:
Biotium
Description:
Llama anti-rabbit CF™ dye conjugates are prepared by labeling affinity purified llama anti-rabbit IgG (H+L) with a selection of CF™ dyes. CF™ dyes offer combined advantages in brightness, photostability, and specificity compared other fluorescent dyes. CF™640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CF™640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CF™640R is its exceptional photostability.
Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Catalog Number:
(10813-660)
Supplier:
Prosci
Description:
The MDC gene is one of several Cys-Cys (CC) cytokine genes which are clustered on the q arm of chromosome 16.
Catalog Number:
(103007-362)
Supplier:
Anaspec Inc
Description:
This peptide amino acids 1 to 17 is a modified fragment of the b-amyloid peptide, with cysteine substituted for valine at position 17.
Sequence: DAEFRHDSGYEVHHQKLC Molecular Weight: 2171.3 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
ACROBIOSYSTEMS INC MS
Description:
Human PSGL-1/CD162 Protein, His, Avitag*, Biotinylated, Source: expressed from HEK293. It contains AA Gln 42 - Cys 320, Predicted N-terminus: Gln 42, protein carries a polyhistidine tag at the C-terminus, followed by an Avi tag, Synonyms: PSGL1, CD162, SELPLG, Selectin P ligand, Size: 25uG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
