Text Search >
N-(Cyclopentylcarbonyl)-beta-alanine
Print…
You Searched For:
30,529 results were found
N-(Cyclopentylcarbonyl)-beta-alanine
Supplier:
Anaspec Inc
Description:
This is scrambled control peptide used in studies to compare the effects of Beta-Amyloid (1-42).
Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA Molecular Weight: 4514.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(102869-006)
Supplier:
R&D Systems
Description:
The Recombinant Mouse TGF-beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse TGF-beta 1 Protein has been validated for the following applications: Bioactivity.
Catalog Number:
(76732-924)
Supplier:
ANTIBODIES.COM LLC
Description:
Human Dopamine beta Hydroxylase ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Dopamine beta Hydroxylase in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number:
(102214-718)
Supplier:
Novus Biologicals
Description:
Rabbit Polyclonal Karyopherin (importin) beta 3 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human.
Catalog Number:
(102104-872)
Supplier:
Novus Biologicals
Description:
The ARNT / HIF-1 beta Antibody (H1beta234) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to ARNT / HIF-1 beta. This antibody reacts with human, mouse, rat, bovine, ferret, primate, sheep. The ARNT / HIF-1 beta Antibody (H1beta234) [DyLight 550] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number:
(220023-640)
Supplier:
R&D Systems
Description:
The Recombinant Human TGF-beta RIII Protein from R&D Systems is derived from NS0. The Recombinant Human TGF-beta RIII Protein has been validated for the following applications: Bioactivity.
Catalog Number:
(103323-962)
Supplier:
Novus Biologicals
Description:
The Nicotinic Acetylcholine Receptor beta Antibody (4G4) from Novus Biologicals is a mouse monoclonal antibody to Nicotinic Acetylcholine Receptor beta. This antibody reacts with human. The Nicotinic Acetylcholine Receptor beta Antibody (4G4) has been validated for the following applications: Western Blot, ELISA.
Catalog Number:
(103402-948)
Supplier:
Novus Biologicals
Description:
The beta-Galactosidase-1 / GLB1 Antibody (1C9) from Novus Biologicals is a mouse monoclonal antibody to beta-Galactosidase-1 / GLB1. This antibody reacts with human, canine, monkey. The beta-Galactosidase-1 / GLB1 Antibody (1C9) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(102869-146)
Supplier:
R&D Systems
Description:
The Recombinant Mouse Integrin alpha 10 beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Integrin alpha 10 beta 1 Protein has been validated for the following applications: Bioactivity.
Catalog Number:
(103269-942)
Supplier:
Novus Biologicals
Description:
The 17 beta-HSD14 / HSD17B14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD14 / HSD17B14. This antibody reacts with human. The 17 beta-HSD14 / HSD17B14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(76464-750)
Supplier:
Boster Biological Technology
Description:
Beta 3 Adrenergic Receptor Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived beta 3 Adrenergic Receptor/ADRB3 recombinant protein, Alternative Names: beta-3 Adrenergic R/ADRB3, ADRB3, ADRB3R, adrenergic, beta-3-, receptor, B3AR, Size: 100ug/vial
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042295-250MG , MDL Number: MFCD01862863
Catalog Number:
(102126-446)
Supplier:
Novus Biologicals
Description:
The CaMKII alpha / beta [p Thr286, p Thr287] Antibody (22B1) from Novus Biologicals is a mouse monoclonal antibody to CaMKII alpha / beta. This antibody reacts with human, mouse, rat. The CaMKII alpha / beta [p Thr286, p Thr287] Antibody (22B1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Catalog Number:
(77526-804)
Supplier:
AFG BIOSCIENCE LLC
Description:
ACTb (Actin Beta) ELISA Kit
Catalog Number:
(103408-888)
Supplier:
Novus Biologicals
Description:
The Nicotinic Acetylcholine Receptor beta 4 Antibody from Novus Biologicals is a goat polyclonal antibody to Nicotinic Acetylcholine Receptor beta 4. This antibody reacts with human, bovine. The Nicotinic Acetylcholine Receptor beta 4 Antibody has been validated for the following applications: Peptide ELISA.
Supplier:
Adipogen
Description:
RELM-beta is a 19kDa disulfide-linked homodimeric protein expressed in the epithelium of the colon and small bowel. RELM-beta has been suggested to play a regulatory role during inflammation and may also act to establish links among adipose tissue, the intestine and the liver. Interestingly, the molecular structure of RELM-beta is highly homologous to that of the adipose-derived cytokine resistin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
