Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

N-(Cyclopentylcarbonyl)-beta-alanine


30,530  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30530"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Genetex
Description:   Mouse monoclonal antibody [M17-P5-F11] to Sodium/Potassium ATPase beta
Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to Laminin beta 1 for WB and ICC/IF with samples derived from Human and Mouse.
Supplier:  Novus Biologicals
Description:   TGF beta Receptor III Overexpression Lysate (Adult Normal)

Supplier:  Novus Biologicals
Description:   The beta-TrCP1 / BTRC Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-TrCP1 / BTRC. This antibody reacts with human, rat. The beta-TrCP1 / BTRC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Supplier:  Novus Biologicals
Description:   The TCF-2 / HNF-1 beta Antibody from Novus Biologicals is a goat polyclonal antibody to TCF-2 / HNF-1 beta. This antibody reacts with human. The TCF-2 / HNF-1 beta Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence, Peptide ELISA.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the mature form of human CBFB (Q13951-1) (Met1-Pro182) was expressed with a polyhistidine tag at the N-terminus.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [S100B/4138] antibody to S100 beta for IHC-P with samples derived from Human.

Supplier:  Novus Biologicals
Description:   The HNF-3 beta / FoxA2 Antibody (7E6.) from Novus Biologicals is a mouse monoclonal antibody to HNF-3 beta / FoxA2. This antibody reacts with human. The HNF-3 beta / FoxA2 Antibody (7E6.) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence, Immunoprecipitation, RNA Inhibition.

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to TGF beta 1 for WB and ICC/IF with samples derived from Human, Mouse and Rat.

Supplier:  Novus Biologicals
Description:   The 17 beta-HSD14 / HSD17B14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD14 / HSD17B14. This antibody reacts with human. The 17 beta-HSD14 / HSD17B14 Antibody has been validated for the following applications: Western Blot.

Supplier:  Novus Biologicals
Description:   The 17 beta-HSD14 / HSD17B14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD14 / HSD17B14. This antibody reacts with human. The 17 beta-HSD14 / HSD17B14 Antibody has been validated for the following applications: Western Blot.
Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to PDGFR beta (phospho Tyr1021) for IHC and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: (101918-900)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 059695-500MG , MDL Number: MFCD03776279
Catalog Number: (89365-066)

Supplier:  Genetex
Description:   Rabbit Polyclonal to Human Beta - 3 Adrenoceptor
Supplier:  AMBEED, INC
Description:   Cytarabine 98%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,529 - 4,544  of 30,530