Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

N-(Cyclopentylcarbonyl)-beta-alanine


30,530  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30530"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   The PKA regulatory subunit I beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PKA regulatory subunit I beta. This antibody reacts with human. The PKA regulatory subunit I beta Antibody has been validated for the following applications: Western Blot.
Catalog Number: (103007-114)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Novus Biologicals
Description:   The Proteasome beta 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome beta 1. This antibody reacts with human, mouse, rat. The Proteasome beta 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042374-1G , MDL Number: MFCD03002713

Supplier:  Novus Biologicals
Description:   The Fc epsilon RI beta / MS4A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fc epsilon RI beta / MS4A2. This antibody reacts with human. The Fc epsilon RI beta / MS4A2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Supplier:  AMBEED, INC
Description:   4-Nitrophenyl-β-D-glucuronide 98%
New Product
Supplier:  Novus Biologicals
Description:   The beta 2-Microglobulin Antibody (B2M / 1118) [PerCP] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate. The beta 2-Microglobulin Antibody (B2M / 1118) [PerCP] has been validated for the following applications: Flow Cytometry, Immunohistochemistry-Paraffin.
Supplier:  Abnova
Description:   Mouse monoclonal antibody raised against recombinant beta 2 (MG).
Catalog Number: (10245-316)

Supplier:  Bioss
Description:   Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Beta-3 is involved in the regulation of lipolysis and thermogenesis.
Supplier:  Rockland Immunochemical
Description:   Recombinant Human NGF beta control protein
Catalog Number: (103358-982)

Supplier:  Novus Biologicals
Description:   The p66 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to p66 beta. This antibody reacts with human, mouse. The p66 beta Antibody has been validated for the following applications: Western Blot.
Supplier:  Novus Biologicals
Description:   The beta Tubulin Antibody (4E4) [DyLight 650] from Novus Biologicals is a mouse monoclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat. The beta Tubulin Antibody (4E4) [DyLight 650] has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Catalog Number: (89349-154)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to Dopamine beta hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
Supplier:  R&D Systems
Description:   The Recombinant Human Integrin alpha 11 beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Human Integrin alpha 11 beta 1 Protein has been validated for the following applications: Bioactivity.

Supplier:  Novus Biologicals
Description:   The Inhibin beta B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Inhibin beta B. This antibody reacts with human. The Inhibin beta B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  MORAVEK BIOCHEMICALS MS
Description:   1-(2-Deoxy-2-fluoro-beta-D-arabinofuranosyl)-5-iodouracil
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,441 - 1,456  of 30,530