Nepsilon-carbobenzoxy-L-lysine
Catalog Number:
(77438-174)
Supplier:
Bioss
Description:
Part of a complex composed of PLOD1, P3H3 and P3H4 that catalyzes hydroxylation of lysine residues in collagen alpha chains and is required for normal assembly and cross-linking of collagen fibrils. Required for normal bone density and normal skin stability via its role in hydroxylation of lysine residues in collagen alpha chains and in collagen fibril assembly.
Catalog Number:
(103009-192)
Supplier:
Anaspec Inc
Description:
This is histone H4 (1-25) with a C-terminal GSGS linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin) MW:3232.7 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(103008-048)
Supplier:
Anaspec Inc
Description:
This peptide is Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:AQKKDGKKRKRSRKESYSIYV-GGK(Biotin) MW:3024.6 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10781-930)
Supplier:
Biosensis
Description:
Lysine acetylation of histones and non-histone proteins plays an important part in many cellular processes such as chromatin and nuclear signaling, transcription, gene silencing, cell cycle progression, apoptosis, differentiation, DNA replication and repair.
Catalog Number:
(89092-712)
![]()
Catalog Number:
(103008-322)
Supplier:
Anaspec Inc
Description:
This peptide is Histone H3 amino acid residues 1-21. It is dimethylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2 MW:2750.2 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(90004-072)
Supplier:
BD
Description:
Decarboxylase media are used in the biochemical differentiation of gram-negative enteric bacilli based on the production of arginine dihydrolase and lysine and ornithine decarboxylase.
Catalog Number:
(103008-112)
Supplier:
Anaspec Inc
Description:
This synthetic peptide corresponds to amino acids 1-25 of human histone H3. It is trimethylated at lysine 4. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLATKAA-NH2 MW:2667.1 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(95022-428)
Supplier:
HiMedia
Description:
For the isolation and biochemical characterization of <i>Yersinia enterocolitica</i>.
Catalog Number:
(95022-430)
Supplier:
HiMedia
Description:
For the isolation and biochemical characterization of<i> Yersinia enterocolitica</i>.
Catalog Number:
(10387-590)
Supplier:
Bioss
Description:
Modulation of the chromatin structure plays an important role in the regulation of transcription in eukaryotes. The nucleosome, made up of four core histone proteins (H2A, H2B, H3 and H4), is the primary building block of chromatin. The N-terminal tail of core histones undergoes different posttranslational modifications including acetylation, phosphorylation and methylation. These modifications occur in response to cell signal stimuli and have a direct effect on gene expression. In most species, the histone H2B is primarily acetylated at lysines 5, 12, 15 and 20. Histone H3 is primarily acetylated at lysines 9, 14, 18 and 23. Acetylation at lysine 9 appears to have a dominant role in histone deposition and chromatin assembly in some organisms. Phosphorylation at Ser10 of histone H3 is tightly correlated with chromosome condensation during both mitosis and meiosis.
Catalog Number:
(75790-580)
Supplier:
Prosci
Description:
SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.
Catalog Number:
(PAL5001)
Supplier:
Promega Corporation
Description:
FluoroTect Green(Lys) in vitro Translation Labeling System allows fluorescent labeling and detection of proteins synthesized in vitro. It is based on a lysine-charged tRNA labeled at the epsilon position of the lysine with the fluorophore BODIPY-FL.
Catalog Number:
(10254-816)
Supplier:
Bioss
Description:
Alpha-aminoadipic semialdehyde synthase (AASS), also designated lysine ketoglutarate reductase (LKR) or saccharopine dehydrogenase (SDH), is a 926 amino acid protein that exists as a homodimer in the mitochondria. AASS acts as a bifunctional enzyme containing the lysine alpha-ketoglutarate reductase (LKR) and saccharopine dehydrogenase activities that catalyzes the first two steps in lysine degradation. It is widely expressed with highest expression in liver and transcription of the AASS gene is induced upon starvation. Mutations in the gene encoding AASS result in various forms familial hyperlysinemias (FH), autosomal recessive disorders characterized by hyperlysinemia, lysinuria, and variable saccharopinuria. However, no adverse mental or physical effects have been found in patients with hyperlysinemia.
Supplier:
Anaspec Inc
Description:
Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end. Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2 MW: 4867.6 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-D-Lys(Mtt)-OH
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||