Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Solid+Phase+Extraction


10,012  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-VERTICAL
 
 
SearchResultCount:"10012"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 1948-33-0 MDL Number: MFCD00002344 Molecular Formula: C10H14O2 Molecular Weight: 166.22 Purity/Analysis Method: 98.0% (GC) Form: ...
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 63-37-6 MDL Number: MFCD00006544 Molecular Formula: C9H14N3O8P Molecular Weight: 323.20 Purity/Analysis Method: 98.0% (HPLC) Form...
MSDS SDS
Supplier:  Brady Worldwide
Description:   Permanent polyester label (B-423) is ideal for electronic PCB and component identification, barcode labels, rating plates, and solar panel identificat...
Supplier:  Bel-Art Products
Description:   This solid, polypropylene plastic stirring rod with rounded end is useful for mixing chemicals and liquids.
Supplier:  Ergomat
Description:   Ergomat Sticky Mats provide a fast, convenient, reliable way to clean shoe soles or other items before entering a clean and sanitary area
Supplier:  M.L. KISHIGO
Description:   Solid Flame Resistant vest offers style and function.
Supplier:  TCI America
Description:   CAS Number: 34592-47-7 MDL Number: MFCD00005212 Molecular Formula: C4H7NO2S Molecular Weight: 133.17 Purity/Analysis Method: 98.0% (HPLC,T) F...
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 2103-64-2 MDL Number: MFCD00041839 Molecular Formula: C20H12O7 Molecular Weight: 364.31 Purity/Analysis Method: 85.0% (HPLC) Form...
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 116258-17-4 MDL Number: MFCD01321292 Molecular Formula: C12H16N2 Molecular Weight: 350.10 Purity/Analysis Method: 98.0% (T) Form:...
MSDS SDS
Supplier:  Starplex
Description:   When leakproof transport is essential, the solid, straight wall design of the container paired with the durable cap creates the optimal fit for preven...
Supplier:  TCI America
Description:   CAS Number: 1655-52-3 MDL Number: MFCD00038106 Molecular Formula: C9H9N3O6 Molecular Weight: 255.19 Purity/Analysis Method: 98.0% (HPLC,T) Fo...
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 6094-36-6 MDL Number: MFCD00014028 Molecular Formula: C12H13NO5 Molecular Weight: 251.24 Purity/Analysis Method: 98.0% (HPLC,T) F...
MSDS SDS
Supplier:  Anaspec Inc
Description:   Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Molecul...
Supplier:  Electron Microscopy Sciences
Description:   Plastic boats are utilized to weigh liquid or solid samples.
Minority or Woman-Owned Business Enterprise
Supplier:  Thermo Scientific
Description:   Choose from solid polystyrene plates in a standard 96-well format or polystyrene modules consisting of twelve 8-well strips
Supplier:  Spectrum Chemicals
Description:   Sodium Selenite, 99.8+ Percent, Powder is the most common selenium compound that is soluble in water. It is a solid that has no color and is a salt. I...
MSDS SDS
Small Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,769 - 4,784  of 10,012