Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Thiophene-2,3-dicarboxylic+acid


145,659  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"145659"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Cayman Chemical Company
Description:   2 3 cGAMP (sodium salt), Purity: >/=98%, Appearance: solid, A second messenger and inducer of IFN-B production, Synonyms: Adenylyl-(3'?5')-2'-guanylic acid, cyclic nucleotide, disodium salt, Guanosine-Adenosine 2',3'-cyclic monophosphate, Size: 1mg
Supplier:  AOB CHEM USA
Description:   5-Bromo-2-chlorobenzo[b]thiophene ≥95%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042024-1G , MDL Number: MFCD02682348
Catalog Number: (103006-368)

Supplier:  Anaspec Inc
Description:   BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AOB CHEM USA
Description:   Benzo[b]thiophen-5-ol ≥97%
New Product
Supplier:  MilliporeSigma
MSDS SDS
Supplier:  AOB CHEM USA
Description:   4-Bromo-2-methylbenzo[b]thiophene ≥95%
New Product
Supplier:  AOB CHEM USA
Description:   2-Bromo-3-chlorobenzo[b]thiophene ≥97%
New Product
Supplier:  AOB CHEM USA
Description:   2-Bromo-7-methylbenzo[b]thiophene ≥95%
New Product
Supplier:  AOB CHEM USA
Description:   2-(Methylthio)thiophene ≥97%
Catalog Number: (89520-020)

Supplier:  Abgent
Description:   Polyclonal antibody, Isotype: Rabbit Ig, Species reactivity: Human, Gene ID: 7873, Target/Specificity: This MANF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human MANF.
Catalog Number: (89520-138)

Supplier:  Abgent
Description:   Polyclonal antibody, Isotype: Rabbit Ig, Species reactivity: Human, Gene ID: 4237, Target/Specificity: This MFAP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human MFAP2.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   N-Boc-4-oxo-L-proline methyl ester 97%
Supplier:  AMBEED, INC
Description:   7-Bromo-2-indoleboronic acid pinacol ester 98%
Supplier:  AMBEED, INC
Description:   4-Chlorobenzo[b]thiophene-2-carbonitrile, Purity: 95%, CAS Number: 1378942-33-6, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100MG
Supplier:  AOB CHEM USA
Description:   3-Bromo-2-methylbenzo[b]thiophene ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,809 - 3,824  of 145,659