Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Iodo-7H-pyrrolo[2,3-d]pyrimidine


181,778  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"181778"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  MORAVEK BIOCHEMICALS MS
Description:   L-Glutamic acid, [3,4-3H] ≥97% (by HPLC), MORpureâ„¢
Supplier:  AMBEED, INC
Description:   2-Bromo-6-methylisonicotinic acid, Purity: 95%, CAS Number: 25462-84-4, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8C, Size: 100MG
Supplier:  AMBEED, INC
Description:   Methyl-5-bromo-2-methylbenzoate 98%
Supplier:  AOB CHEM USA
Description:   3-Bromo-5-chloro-2-fluoro-6-hydroxybenzoic acid ≥97%
Supplier:  AMBEED, INC
Description:   (4-Bromo-2,3,5,6-tetrafluorophenyl)boronic acid 95%
Catalog Number: (76983-822)

Supplier:  AMBEED, INC
Description:   3-Bromo-4-ethylbenzoic acid, Purity: 97%, CAS number: 99548-53-5, Appearance: White to off-white powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 5G
Catalog Number: (101817-428)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 024108-500MG , MDL Number: MFCD07187804
Supplier:  AOB CHEM USA
Description:   6-Bromo-2-fluoro-3-hydroxybenzoic acid ≥97%
Supplier:  AOB CHEM USA
Description:   3-Bromo-4-chloro-2-fluorobenzoic acid ≥97%
Supplier:  APOLLO SCIENTIFIC
Description:   3-Bromo-5-fluoro-2-methylphenylboronic acid
Supplier:  AOB CHEM USA
Description:   (3-Bromo-5-fluoro-2-methoxyphenyl)boronic acid ≥97%

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  AOB CHEM USA
Description:   6-Bromo-2,3-dichlorophenylboronic acid pinacol ester ≥97%
Supplier:  AOB CHEM USA
Description:   4-Bromo-3-chloro-2-fluorophenylboronic acid pinacol ester ≥97%
Supplier:  AMBEED, INC
Description:   (4-Bromo-5-chlorothiophen-2-yl)boronic acid 96%
Supplier:  AOB CHEM USA
Description:   3-Bromo-2-chloro-6-fluoro-5-methylbenzoic acid ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,809 - 7,824  of 181,778