Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

3-((4-Methoxybenzyl)oxy)propan-1-ol


7,860  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"7860"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (77042-458)

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to IKK-beta (phospho Tyr199) for WB, IHC and ELISA with samples derived from Human, Mouse and Rat
.
Catalog Number: (89365-066)

Supplier:  Genetex
Description:   Rabbit Polyclonal to Human Beta - 3 Adrenoceptor
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [AMC0499] antibody to beta Tubulin for WB with samples derived from Human, Mouse and Rat.
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant mouse monoclonal [rCTNNB1/7358] antibody to beta Catenin for IHC-P with samples derived from Human.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [IL1B/6687] antibody to IL-1 beta for ELISA and IHC-P with samples derived from Human.
Supplier:  R&D Systems
Description:   Neuron-specific beta-III Tubulin NL493 monoclonal antibody (Clone TuJ-1), Isotype: Mouse IgG2A, Applications: Immunocytochemistry, 0.5 ML
Catalog Number: (77048-832)

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to IL-3R beta for WB, IHC and ELISA with samples derived from Human, Mouse and Rat.

Supplier:  Novus Biologicals
Description:   Rabbit Polyclonal IL1 beta Antibody [Biotin]. Tested Applications: Western Blot, ELISA, Immunohistochemistry. Tested Reactivity: Mouse, Rat.
Catalog Number: (101095-788)

Supplier:  USP
Description:   (500 mg) (2-Phenoxyethanol)
Supplier:  Bioss
Description:   The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Integrin alpha-V/beta-1 is a receptor for vitronectin. Beta-1 integrins recognize the sequence R-G-D in a wide array of ligands. Isoform 2 interferes with isoform 1 resulting in a dominant negative effect on cell adhesion and migration (in vitro).
Catalog Number: (RL000-001-L00)

Supplier:  Rockland Immunochemical
Description:   Beta Amyloid Control Peptide
Catalog Number: (89349-602)

Supplier:  Genetex
Description:   Rabbit Polyclonal antibody to GRK3 (adrenergic, beta, receptor kinase 2)
Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Dog Caninea TGF-beta 3
Supplier:  Bioss
Description:   Glycogen synthase kinase 3 (GSK3) is a proline directed serine threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. GSK3 has been implicated in fundamental cell processes such as cell fate determination, metabolism, transcriptional control and oncogenesis. Two isoforms, alpha (GSK3A; OMIM 606784) and beta, show a high degree of amino acid homology within their catalytic domains. GSK3B is involved in energy metabolism, neuronal cell development and body pattern formation.
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal [9F2] antibody to beta Catenin for Flow Cytometry, IF and WB with samples derived from Human, Bovine, Canine and Chicken.
Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,257 - 4,272  of 7,860