Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+2-bromo-4-isopropylbenzoate


15,958  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"15958"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Clofazimine 98%
Supplier:  AMBEED, INC
Description:   2-[Bis(2,4-di-tert-butyl-phenoxy)phosphinooxy]-3,5-di(tert-butyl)phenyl-palladium(II) chloride dimer, Purity: 98%, CAS Number: 217189-40-7, Appearance: White to Pale-green to Gray Powder or crystals, Storage: Inert atmosphere, 2-8 C, Size: 1g
Catalog Number: (103007-366)

Supplier:  Anaspec Inc
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Strem Chemicals Inc
Description:   CAS #: 1317-35-7. Size: 250g.
Supplier:  Thermo Scientific Chemicals
Description:   1G
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   98%
MSDS SDS

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 029880-500MG , MDL Number: MFCD00173770
Supplier:  AMBEED, INC
Description:   tert-Butyl (S)-2-((S)-2-(2-(3,5-difluorophenyl)acetamido)propanamido)-2-phenylacetate, Purity: 98%, CAS Number: 208255-80-5, Appearance: Form: Crystal - Powder/Colour: White - Slightly pale yellow, Storage: Keep in dark place, Sealed in dry, Store in freezer, under -20 C, Size: 10mg
Supplier:  AMBEED, INC
Description:   rel-N-(5-(3,5-Dimethoxyphenethyl)-1H-pyrazol-3-yl)-4-((3R,5S)-3,5-dimethylpiperazin-1-yl)benzamide, Purity: 98%, CAS Number: 1035270-39-3, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Keep in dark place, Sealed in dry, Store in freezer, under -20C, Size: 10MG
Supplier:  Strem Chemicals Inc
Description:   Metal TMHD
Supplier:  TCI America
Description:   4-Chloroquinoline, Purity: >97.0%(GC), CAS Number: 611-35-8, Molecular Formula: C9H6ClN, Molecular Weight: 163.60, Size: 5G
Supplier:  Matrix Scientific
Description:   MF=C10H5F6N3S MW=313.23 Cas=175276-77-4 MDL=MFCD00052515 ,1G
Supplier:  AMBEED, INC
Description:   Monomethyl 1,4-Dihydro-2,6-dimethyl-4-(3-nitrophenyl)-3,5-pyridinedicarboxylate 98%
New Product
Supplier:  Matrix Scientific
Description:   MF=C8H11Bo4 MW=181.99 Cas=122775-35-3 MDL=MFCD01074574 5G
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis[3,5-bis(trifluoromethyl)phenyl]-5,5',6,6',7,7',8,8'-octahydro-1,1'-binaphthyl-2,2'-diyl Hydrogen Phosphate, Purity: 98%, CAS Number: 2229836-07-9, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 250mg
Supplier:  TCI America
Description:   Ribostamycin Sulfate, Purity: >90.0%(N), CAS Number: 53797-35-6, Molecular Formula: C17H34N4O10.Xh2so4, Size: 1G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,025 - 3,040  of 15,958