Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl+4-[(1S)-1-aminoethyl]benzoate


32,202  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"32202"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   5,6-Dimethylpyrazin-2(1H)-one, Purity: 97%, CAS Number: 57229-36-4, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 1g
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   2,4-Difluorobenzaldehyde 98%
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   2,6-Difluoropyridine 99%
Supplier:  APOLLO SCIENTIFIC
Description:   2-Cyanoethyl-N,N,N',N'-tetraisopropylphosphordiamidite 95+%
Supplier:  Anaspec Inc
Description:   This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.
Sequence:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4049.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (TS31163-0050)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   2,6-Difluorophenol 98%

Supplier:  R&D Systems
Description:   The Recombinant Human IL-36 alpha/IL-1F6 (aa 6-158) Protein from R&D Systems is derived from E. coli. The Recombinant Human IL-36 alpha/IL-1F6 (aa 6-158) Protein has been validated for the following applications: Bioactivity.
Supplier:  AMBEED, INC
Description:   5-Nitro-2,4,6-triaminopyrimidine, Purity: 95%, CAS Number: 24867-36-5, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8 deg C, Size: 1g
Supplier:  AOB CHEM USA
Description:   (2-(Benzyloxy)-5-bromo-3-methoxyphenyl)methanol ≥97%
Supplier:  AMBEED, INC
Description:   (5-Acetamido-2-nitro)benzeneboronicacid, Purity: 98%, CAS Number: 78887-36-2, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  TCI America
Description:   Diethyl (Bromodifluoromethyl)phosphonate, CAS Number: 65094-22-6, Purity: 97.0%, Molecular Formula: C5H10BrF2O3P, Molecular Weight: 267.01 g/mol, Synonyms: (Bromodifluoromethyl)phosphonic Acid Diethyl Ester, Physical Form: Solid, Size: 5G
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 22122-36-7
MDL Number: MFCD00191545
Molecular Formula: C5H6O2
Molecular Weight: 98.10
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 98
Flash Point (°C): 93
Specific Gravity (20/20): 1.12
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 28177-48-2
MDL Number: MFCD00002158
Molecular Formula: C6H4F2O
Molecular Weight: 130.09
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 60
Melting point (°C): 45
Flash Point (°C): 58
MSDS SDS
Supplier:  AMBEED, INC
Description:   1-Methyl-1H-pyrrolo[2,3-b]pyridine-3-carbaldehyde, Purity: 97%, CAS Number: 171919-36-1, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  Matrix Scientific
Description:   MF=C9H6F4O2 MW=222.14 CAS=176694-36-3 MDL=MFCD06203709 1G
Supplier:  AMBEED, INC
Description:   H-Phe(2,4-DiCl)-OH, Purity: 98+%, CAS Number: 111119-36-9, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,377 - 5,392  of 32,202