Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2,3-Bis(amino((2-aminophenyl)thio)methylene)succinonitrile+compou


101,688  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
Your search request has been modified to limit number of results. Your search was -
2,3-Bis(amino((2-aminophenyl)thio)methylene)succinonitrile+compound+with+ethanol+(1:1)
 
 
SearchResultCount:"101688"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (77404-886)

Supplier:  APOLLO SCIENTIFIC
Description:   1,3-Oxazolo[4,5-b]pyridine-2-thiol
Supplier:  AMBEED, INC
Description:   Cimetidine 98%
New Product

Supplier:  PeproTech, Inc.
Description:   BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with an osteoconductive carrier such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 appears to play an important role in cardiac morphogenesis, and is expressed in a variety of other tissues, including lung, liver, spleen, prostate, ovary, and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains (monomers) linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human/Murine/Rat BMP-2 derived from CHO cells is a homodimeric glycoprotein that consists of two 114 amino acid polypeptide chains linked by a single disulfide bond. Due to glycosylation, CHO cell-derived Human/Murine/Rat BMP-2 migrates at an apparent molecular weight of approximately 28-29 kDa by SDS-PAGE analysis under non-reducing conditions.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Triethyloxonium tetrafluoroborate 1M in methylene chloride, AcroSeal®
New Product
Catalog Number: (77627-618)

Supplier:  AMBEED, INC
Description:   Cefodizime sodium ≥97%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 035492-25G , MDL Number: MFCD00013111
Supplier:  AMBEED, INC
Description:   (E)-Methyl 2-((dimethylamino)methylene)-3-oxobutanoate, Purity: 97%, CAS Number: 203186-56-5, Appearance: Light-yellow to yellow powder or crystals, Storage: Sealed in dry, 2-8 C, Size: 1g
Supplier:  Honeywell Research Chemicals
Description:   Dichloromethane (DCM, Methylene chloride) is an organic compound with formula CH<sub>2</sub>Cl<sub>2</sub>. This colorless, volatile liquid has a moderately sweet odor and is widely used as a solvent. Although it is not miscible with water, it is miscible with many organic solvents. Suitable for HPLC and spectrophotometry.
MSDS SDS
Catalog Number: (10276-850)

Supplier:  Bioss
Description:   Sorting nexin 1 (SNX1) is a member of a large family of hydrophilic proteins that interact with a variety of receptor types and are involved in intracellular trafficking (1). SNX1 and the related splice variant, SNX1A, bind the epidermal growth factor (EGF) receptor, facilitate its transport to lysosome, and thereby contribute to the degradation of the receptor (2,3). SNX2 and SNX4 share a high degree of amino acid similarity with SNX1, as they all contain a characteristic phox homology (PX) domain (4). These proteins are all partially associated with cellular membranes, and they, likewise, associate with EGF, PDGF and insulin receptor tyrosine kinases (2). These nexins are widely expressed and yet have various tissue distribution patterns. Additionally, the sorting nexins can associate with each other and with a variety of other cellular proteins, suggesting that they exist as part of multisubunit complexes (1,5). The related protein, SNX3, comprises a distinct subgroup of nexins that share less sequence similarity outside of the PX domain and have dramatically different binding affinities for the tyrosine kinase receptors (2,6).
Supplier:  AMBEED, INC
Description:   1-(4-(Diisobutylamino)-2'-(2H-tetrazol-5-yl)-[1,1'-biphenyl]-3-yl)-3-(p-tolyl)urea, Purity: 98+%, CAS Number: 1668565-74-9, Appearance: White to off white powder or crystals, Storage: Sealed in dry, Store in freezer, under -20 C, Size: 1mg
Supplier:  Honeywell Research Chemicals
Description:   Dichloromethane, Contains Cyclohexene Preservative, CAS number: 75-09-2, Structural formula: CH2Cl2, Molecular weight: 84.93, For Pesticide Residue Analysis, Synonym: Methylene Chloride, DCM, Applications: HPLC, Pesticide residue analysis, Spectrophotometry, Size: 200L
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Stabilized with amylene
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 046399-500MG , MDL Number: MFCD09607896
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Dichloromethane, extra dry over Molecular Sieve 99.8% stabilized, AcroSealâ„¢
Supplier:  Bioss
Description:   Wolfram syndrome protein (WFS1) is an 890 amino acid protein that contains a cytoplasmic N-terminal domain, followed by nine-transmembrane domains and a luminal C-terminal domain. WFS1 is predominantly localized to the endoplasmic reticulum (ER) (1) and its expression is induced in response to ER stress, partially through transcriptional activation (2,3). Research studies have shown that mutations in the WFS1 gene lead to Wolfram syndrome, an autosomal recessive neurodegenerative disorder defined by young-onset, non-immune, insulin-dependent diabetes mellitus and progressive optic atrophy (4).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,009 - 1,024  of 101,688