Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Bromo-3,6-dimethoxybenzoic+acid


175,057  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"175057"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Anaspec Inc
Description:   This peptide is Histone 3 amino acid residues 21 to 44. It is mono-methylated at Lys27 and Lys36 with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. Related Peptides: [Lys(Ac)27, Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K27(Ac)K36(Me1), biotin-labeled, Cat# 65444 [Lys(Ac)27, Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K27(Ac)K36(Me2), biotin-labeled, Cat# 65445
Sequence:ATKAAR-K(Me1)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2946.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  TCI America
Description:   CAS Number: 503-66-2
Molecular Formula: C3H6O3
Molecular Weight: 90.08
Form: Liquid
Color: Colorless
MSDS SDS
Catalog Number: (470149-168)

Supplier:  Shiv Dial Sud & Sons
Description:   CAS Number: 65997-19-5
Formula: Fe
Density: 7.86 g/mL
Freezing Point: 1535 °C
Solubility: Sulfuric Acid and Hydrochloric Acid
Synonyms: Iron Aggregate
Shelf Life: 36 Months

Supplier:  Bioss
Description:   Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY >NPY >PYY (3-36) >NPY (2-36) >[Ile-31, Gln-34] PP >[Leu-31, Pro-34] NPY >PP, [Pro-34] PYY and NPY free acid.
Supplier:  Bioss
Description:   Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY >NPY >PYY (3-36) >NPY (2-36) >[Ile-31, Gln-34] PP >[Leu-31, Pro-34] NPY >PP, [Pro-34] PYY and NPY free acid.

Supplier:  Biotium
Description:   Free acid form of 6-TAMRA (6-carboxytetramethylrhodamine) single isomer. 6-Carboxytetramethylrhodamine, triethylammonium salt is a single isomer rhodamine dye. The 6-carboxy group can be activated to succinimidyl ester or mixed anhydride for coupling with amines using standard methods.

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  MORAVEK BIOCHEMICALS MS
Description:   Decanoic acid, [1-14C] ≥97% (by HPLC)
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   4-Methoxysalicylic acid 99%
Supplier:  Spectrum Chemicals
Description:   D-Glucurono-3,6-lactone, also known as glucuronolactone, is a natural chemical that is a component of almost all connective tissues. It is used as a precursor for ascorbic acid synthesis.
Small Business Enterprise
Supplier:  Sino Biological
Description:   A DNA sequence encoding the Influenza A virus (A/Babol/36/2005 (H3N2)) neuraminidase (ACN50232.1) (His 36-Pro 459) was expressed, the cell lysates are collected, and bio-activity was tested. There is an amino acid change from Glutamic to Valine (E119V mutation) in NA / Neuraminidase.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the Influenza A virus (A/Babol/36/2005 (H3N2)) neuraminidase (ACN50232.1) (His 36-Pro 459) was expressed, the cell lysates are collected, and bio-activity was tested. There is an amino acid change from Histidine to Tyrosine (H274Y mutation) in NA / Neuraminidase.
Supplier:  AMBEED, INC
Description:   3-(Propionyloxy)benzoic acid 97%
Supplier:  AOB CHEM USA
Description:   3-Amino-4-chlorophenylboronic acid ≥95%
Supplier:  AMBEED, INC
Description:   2-Methyl-3-pivalamidobenzoic acid 95%
Supplier:  Anaspec Inc
Description:   PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,057 - 1,072  of 175,057
Prev   67  68  69  70  71  72  73  74  75  76  77  78  79  80  81  82  Next