Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Dibenzyl+phosphate


156,489  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"156489"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   Boc-D-Chg-OH 97%
New Product
Supplier:  Bachem Americas
Description:   Sequence: Boc-D-His(3-Bom)-OH
Supplier:  Bachem Americas
Description:   Compared to the TFA salt, the HCl salt of amyloid β-protein (1-40) easily forms β-structures in PBS within a few hours at 25°C. β-structure formation is essential for amyloid peptide toxicity.
Sequence: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Salt: Hydrochloride
Catalog Number: (A-3015.0250BA)

Supplier:  Bachem Americas
Description:   Sequence: Boc-D-His(1-Me)-OH
Supplier:  Anaspec Inc
Description:   GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (102997-478)

Supplier:  Anaspec Inc
Description:   These peptides are potential substrates for EGFR protein tyrosine kinases. The fluorescent and biotinylated peptides are used to design assays for CaMKs.
Sequence:ADEYLIPQQ
MW:1076.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (103006-280)

Supplier:  Anaspec Inc
Description:   This peptide is a H-2Kd-restricted epitope from Influenza nucleoprotein (147-155).
Sequence:TYQRTRALV
MW:1107.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  AMBEED, INC
Description:   Boc-Abu-OH 97%
Supplier:  AMBEED, INC
Description:   Boc-Cha-OH 98%
Supplier:  Bachem Americas
Description:   Sequence: Boc-Nle-OH (syrup)
Synonym(s): Boc-L-2-aminohexanoic acid (syrup)
Supplier:  Bachem Americas
Description:   Sequence: Boc-Arg(Z)â‚‚-OH
Catalog Number: (102996-368)

Supplier:  Anaspec Inc
Description:   This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  AMBEED, INC
Description:   Boc-D-His(Tos)-OH 98%
Supplier:  AMBEED, INC
Description:   Boc-2-Abz-OH 95%
Supplier:  AMBEED, INC
Description:   Boc-D-Cha-OH 98%
Catalog Number: (103006-268)

Supplier:  Anaspec Inc
Description:   The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:RQIKIWFQNRRMKWKK
MW:2246.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,577 - 4,592  of 156,489