4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid
Catalog Number:
(10116-566)
Supplier:
Prosci
Description:
Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: RAD9A antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of RAD9A; Application: ELISA, Western Blot
Catalog Number:
(10114-850)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat; Target Species: Human; Immunogen: ABCC8 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of ABCC8; Applications: ELISA,Western blotting
Catalog Number:
(10113-908)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: LMP7 antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of LMP7, Tested Applications: ELISA, WB
Catalog Number:
(10358-056)
Supplier:
Bioss
Description:
Insulin is a pancreatic hormone that regulates glucose and is involved in the synthesis of protein and fat. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Heterodimer of a B chain and an A chain linked by two disulfide bonds.Belongs to the insulin family. The insulin-link growth factors, IGF-I and IGF-II (also desinated somatomedin C and multiplication stimulating activator, respectvely), share approximatly 76% sequence identity and are 50% related to pro-insulin.IGF-I and IGF-II are nonglycosylated, single chain proteins of 70 and 76 amino acids in length, respectivelly. IGF-I functions as an autocrine regulator of growth in vaious, whereas the function of IGF-II is less well defined.
Catalog Number:
(10671-736)
Supplier:
Bioss
Description:
Members of the class-III pyridoxal-phosphate-dependent aminotransferase family, such as AGXT2, catalyze the conversion of glyoxylate to glycine using L-alanine as the amino donor. AGXT2 protects from asymmetric dimethylarginine (ADMA)-induced inhibition in nitric oxide (NO) production. Elevated blood concentrations of ADMA, a methyl derivate of the amino acid arginine and an endogenous inhibitor of nitric oxide (NO) synthase, is produced by the physiological degradation of methylated proteins and is found in association with diabetes, hypertension, congestive heart failure and atherosclerosis. AGXT2L2 (alanine-glyoxylate aminotransferase 2-like 2) is a 450 amino acid pyridoxal phosphate that exists as a homotetramer. Belonging to the class-III pyridoxal-phosphate-dependent aminotransferase family, AGXT2L2 localizes to the mitochondria and exists as three alternatively spliced isoforms. Encoded by a gene located on human chromosome 5q35.3, AGXT2L2 may have similar functions as AGXT2.
Catalog Number:
(10671-756)
Supplier:
Bioss
Description:
Members of the class-III pyridoxal-phosphate-dependent aminotransferase family, such as AGXT2, catalyze the conversion of glyoxylate to glycine using L-alanine as the amino donor. AGXT2 protects from asymmetric dimethylarginine (ADMA)-induced inhibition in nitric oxide (NO) production. Elevated blood concentrations of ADMA, a methyl derivate of the amino acid arginine and an endogenous inhibitor of nitric oxide (NO) synthase, is produced by the physiological degradation of methylated proteins and is found in association with diabetes, hypertension, congestive heart failure and atherosclerosis. AGXT2L2 (alanine-glyoxylate aminotransferase 2-like 2) is a 450 amino acid pyridoxal phosphate that exists as a homotetramer. Belonging to the class-III pyridoxal-phosphate-dependent aminotransferase family, AGXT2L2 localizes to the mitochondria and exists as three alternatively spliced isoforms. Encoded by a gene located on human chromosome 5q35.3, AGXT2L2 may have similar functions as AGXT2.
Catalog Number:
(76109-470)
Supplier:
Bioss
Description:
Arginase I which is expressed almost exclusively in the liver, catalyzes the conversion of arginine to ornithine and urea . The human arginase I gene, which maps to chromosome 6q23, encodes a 322 amino acid protein. Arginase I exists as a homotrimeric protein and contains a binuclear manganese cluster. Arginase II catalyzes the same reaction as arginase I, but differs in its tissue specificity and subcellular location. Specifically, arginase II localizes to the mitochondria. Arginase II is expressed in non-hepatic tissues, with the highest levels of expression in the kidneys, but, unlike arginase I, is not expressed in liver. The human arginase II gene, which maps to chromosome 14q24.1-q24.3, encodes a 354 amino acid protein. In addition, arginase II contains a putative amino-terminal mitochondrial localization sequence.
Supplier:
Anaspec Inc
Description:
This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) MW:3464.1 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Supplier:
Strem Chemicals Inc
Description:
CAS #: 6381-92-6. Size: 1000g.
Catalog Number:
(A-3200.0005BA)
Supplier:
Bachem Americas
Description:
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Catalog Number:
(76195-864)
Supplier:
Prosci
Description:
Recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Catalog Number:
(10112-820)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: P4HA1 antibody was raised against a 13 amino acid synthetic peptide near the internal region of P4HA1, Application: ELISA, WB
Catalog Number:
(10112-092)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: SH2D1A antibody was raised against a 14 amino acid synthetic peptide near the internal region of SH2D1A, Application: ELISA, WB
Catalog Number:
(10112-734)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: NOD2 antibody was raised against a 15 amino acid synthetic peptide near the internal region of NOD2, Application: ELISA, WB
Catalog Number:
(10112-638)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: FGF23 antibody was raised against a 13 amino acid synthetic peptide near the internal region of FGF23, Application: ELISA, WB
Catalog Number:
(10115-356)
Supplier:
Prosci
Description:
Polyclonal antibody CDX2 Host: Goat immunogen: CDX2 antibody was raised against a 14 amino acid synthetic peptide near the internal region of CDX2 Application: ELISA, WB
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||