Text Search >
4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid
Print…
You Searched For:
162,730 results were found
4-[(3-Hydroxybutyl)amino]-3-nitrobenzoic+acid
Catalog Number:
(77438-006)
Supplier:
Bioss
Description:
Translational regulator that ensures constant high levels of translation under amino acid starvation. Acts by interacting with GCN1/GCN1L1, thereby preventing activation of GCN2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis (By similarity). May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis (By similarity). Through its action on GCN2, may also facilitate neuritogenesis (By similarity).
Supplier:
Prosci
Description:
NT-3 is a neurotrophic factor structurally related to β-NGF, BDNF, and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. NT-3 is expressed by neurons of the central nervous systems and can signal through the trk receptors. NT-3 promotes the growth and survival of nerve and glial cells. The amino acid sequences of human, murine and rat NT-3 are identical. Recombinant human NT-3 is a noncovalently linked homodimer, of two 13.6 kDa polypeptide monomers (240 total amino acid residues). Human and Mouse NT-3 sequences are identical.
Catalog Number:
(10109-130)
Supplier:
Prosci
Description:
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
Catalog Number:
(103007-364)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG Molecular Weight: 4035.5 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10108-762)
Supplier:
Prosci
Description:
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
Supplier:
Thermo Scientific Chemicals
Description:
w,N^w'-Di-Boc-N^a-Fmoc-L-arginine, 95%
Supplier:
MP Biomedicals
Description:
Reactive yellow 86, yellow powder
Supplier:
Prosci
Description:
FGF-9 is a heparin binding growth factor that belongs to the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-9 targets glial cells, astrocytes cells and other cells that express the FGFR 1c, 2c, 3b, 3c, and 4. Recombinant human FGF-9 is a 23.4 kDa protein consisting of 207 amino acid residues. Recombinant murine FGF-9 is a 23.3 kDa protein containing 205 amino acid residues.
Catalog Number:
(75790-206)
Supplier:
Prosci
Description:
Cell Growth Regulator with EF Hand Domain Protein 1 (CGREF1) is a secreted calcium ion binding protein. CGREF1 contains two EF-hand domains and both EF-hands are required for function. Human CGREF1 is synthesized as a 301 amino acid precursor that contains a 19 amino acid signal sequence, and a 282 amino acid mature chain. CGREF1 is probably digested extracellularly by an unknown serine protease generating extremely hydrophobic bioactive peptides. CGREF1 mediates cell-cell adhesion in a calcium-dependent manner. In addition, CGREF1 is able to inhibit growth in several cell lines.
Catalog Number:
(75789-312)
Supplier:
Prosci
Description:
Protein FAM3D is a novel cytokine-like protein that belongs to the FAM3 family. Human FAM3D is synthesized as a 224 amino acid precursor that contains a 25 amino acid signal sequence and a 199 amino acid mature chain. FAM3D is identified based on structural, but not sequence, homology to short chain cytokines including IL-2, IL-4 and GM-CSF. FAM3 proteins are four helix bundle cytokines with four conserved cysteines in all members (FAM3A-D). FAM3B is highly expressed in alpha and beta cells of the pancreas and is being investigated as a potential contributor to beta cell death and development of Type I Diabetes.
Catalog Number:
(101824-890)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 027807-500MG , MDL Number: MFCD06809636
Catalog Number:
(76804-292)
Supplier:
AMBEED, INC
Description:
(S)-2-(2-Amino-3-phenylpropanamido)acetic acid, Purity: 95%, CAS Number: 721-90-4, Appearance: Solid, Storage: Keep in dark place, Sealed in dry, 2-8C, Size: 250MG
Supplier:
MP Biomedicals
Description:
Tricine, a zwitterionic buffer, was first prepared by good for use as a buffer for chloroplast reactions. It is structurally similar to Tris, but is much less inhibitory at high concentrations. The name tricine comes from tris and glycine from which it was derived.
Supplier:
TCI America
Description:
CAS Number: 76985-09-6
MDL Number: MFCD00038546 Molecular Formula: C13H13NO2 Molecular Weight: 215.25 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal Specific rotation [a]20/D: 13 deg (C=1, 1mol/L HCl)
Supplier:
AMBEED, INC
Description:
Moc-Val-OH 98%
Catalog Number:
(10072-880)
Supplier:
Prosci
Description:
The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are expressed in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF1 is essential for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. Recombinant human TFF1 is a 6.7 kDa monomeric protein consisting of a 60 amino acid polypeptide chain, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
