Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-(Dimethylamino)-3-nitrobenzoic+acid


14,460  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"14460"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (102996-094)

Supplier:  Anaspec Inc
Description:   Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Matrix Scientific
Description:   1-Boc-3, 4, 5, 7-Tetrahydro-4-Oxo-6H-Pyrrolo[3, 4-D]Pyrimidine, MF=C11H15N3O3, MW=237.26, CAS=1229455-14-4, 1G
MSDS SDS
Supplier:  AMBEED, INC
Description:   Isobutyl palmitate 98%
Supplier:  Thermo Scientific Chemicals
Description:   98%. 10g.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Potent inhibitor of EGF receptor kinase activity
MSDS SDS
Supplier:  Novus Biologicals
Description:   The CD2 Antibody (OX-34) [HRP] from Novus Biologicals is a mouse monoclonal antibody to CD2. This antibody reacts with rat. The CD2 Antibody (OX-34) [HRP] has been validated for the following applications: Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Supplier:  TCI America
Description:   2,6-Dichloropyridine-3-boronic Acid, CAS Number: 148493-34-9, Molecular Formula: C5H4BCl2NO2, Molecular Weight: 191.80, Form: Crystal-Powder, Solid, Color: White - Very pale yellow, Size: 5G
MSDS SDS
Supplier:  AOB CHEM USA
Description:   (E)-methyl 3-(2,3-difluorophenyl)acrylate ≥97%
Supplier:  Thermo Scientific Chemicals
Description:   100ml CAS: 10294-34-5, MDL: MFCD00011313
MSDS SDS
Supplier:  AMBEED, INC
Description:   (4R,4'R)-2,2'-(1,3-Bis(4-(tert-butyl)phenyl)propane-2,2-diyl)bis(4-isopropyl-4,5-dihydrooxazole), Purity: 97%, CAS Number: 2757082-34-9, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   (11bS)-N,N,2,6-Tetramethyldinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-amine, Purity: 98% 99%ee, CAS number: 185449-86-9, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 1G
Supplier:  Matrix Scientific
Description:   MF=C15H12N2O3 MW=268.27 Cas=17288-34-5 1G
Supplier:  Enzo Life Sciences
Description:   GTPase inhibitor
Supplier:  AMBEED, INC
Description:   5-Chloro-2-fluorophenetole 95%
Supplier:  AMBEED, INC
Description:   2,6-Dibromo-4,4-bis(2-ethylhexyl)-4H-cyclopenta[1,2-b:5,4-b']dithiophene, Purity: 97%, CAS number: 365547-21-3, Appearance: Liquid, Storage: Inert atmosphere, 2-8C, Size: 100MG
Supplier:  AMBEED, INC
Description:   N-Ethyl-N-methylcarbamoyl Chloride, Purity: 98%, CAS number: 42252-34-6, Appearance: Form: liquid / Colour: Colorless - Yellow-brown, Storage: Inert atmosphere, 2-8C, Size: 10G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,297 - 7,312  of 14,460