Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(5-Bromo-4-ethylpyridin-3-yl)methanol


56,217  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"56217"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 023579-500MG , MDL Number: MFCD08687131
Supplier:  TCI America
Description:   [Derivatizing Reagent for GC of Inorganic Anions]
CAS Number: 32974-36-0
MDL Number: MFCD06248628
Molecular Formula: C14H9F5O3S
Molecular Weight: 352.28
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 78
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 119-36-8; EC No: 204-317-7; MDL No: MFCD00002214; RTECS: VO4725000 Liquid; Linear Formula: HOC6H4COOCH3; Molecular Formula: C8H8O3; MW: 152.15 Melting Point: -8°; Boiling Point: 222°; Flash point: 96°C (205°F) Density (g/mL): 1.174; Refractive Index: 1.536 Light Sensitive
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C17H24Cln3Os MW=353.92 ,250Mg
Supplier:  TCI America
Description:   CAS Number: 106-36-5
MDL Number: MFCD00009373
Molecular Formula: C6H12O2
Molecular Weight: 116.16
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 122
Flash Point (°C): 27
Specific Gravity (20/20): 0.88
MSDS SDS
Supplier:  AMBEED, INC
Description:   Disodium uridine-5-monophosphate, Purity: 98%, CAS number: 3387-36-8, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 5G
Supplier:  TCI America
Description:   3-Hydroxy-1-methacryloyloxyadamantane, Purity: >98.0%(GC), CAS Number: 115372-36-6, MF: C14H20O3, MW: 236.31, Synonym: 3-Hydroxy-1-adamantyl Methacrylate, Methacrylic Acid 3-Hydroxy-1-adamantyl Ester, Physical state: Solid, Form: Crystal - Powder, Size: 5G
MSDS SDS
Supplier:  AMBEED, INC
Description:   Boc-Pyr-Obzl, Purity: 97%, CAS Number: 113400-36-5, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8C, Size: 100G
Supplier:  TCI America
Description:   3-Hydroxyphenyl Benzoate, Purity: >95.0%(GC), CAS number: 136-36-7, Molecular Formula: C13H10O3, MW: 214.22, Synonym: Benzoic Acid 3-Hydroxyphenyl Ester, Resorcinol Monobenzoate, Physical state: Solid, Form: Crystal - Powder, Colour: White - Reddish yellow, Size: 25G
MSDS SDS
Supplier:  Electron Microscopy Sciences
Description:   Agarose I™ is standard melting/gelling agarose, suitable for routine nucleic acid analytical/preservative applications
Minority or Woman-Owned Business Enterprise
Supplier:  TCI America
Description:   Ethyl 6-Methyl-2-oxo-4-phenyl-1,2,3,4-tetrahydropyrimidine-5-carboxylate, Purity: >98.0%(HPLC)(N), CAS Number: 5395-36-8, Molecular Formula: C14H16N2O3, Synonym: 6-Methyl-2-oxo-4-phenyl-1,2,3,4-tetrahydropyrimidine-5-carboxylic Acid Ethyl Ester, Form: Crystal-Powder, Size: 200MG
MSDS SDS
Catalog Number: (103006-340)

Supplier:  Anaspec Inc
Description:   This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.
Sequence:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
MW:4195.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   Certificate of lot analysis provided.
MSDS SDS
Supplier:  AMBEED, INC
Description:   2-Chlorophenyl trifluoromethanesulfonate 98+%
Supplier:  BeanTown Chemical
Description:   CAS: 3387-36-8; EC No: 222-211-9; MDL No: MFCD00006525; RTECS: YU7975000 Solid; Molecular Formula: C9H11N2O9P; MW: 368.14 Melting Point: 209° (decomposes)
MSDS SDS
Supplier:  Honeywell Research Chemicals
Description:   Titration indicator for SO<sub>4</sub>.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
673 - 688  of 56,217