Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

N-Benzoyl-2'-deoxyadenosine


158,087  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"158087"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   Ethyl 2-Chloro-6-fluorophenylacetate, Purity: >98.0%(GC), CAS Number: 214262-85-8, MF: C10H10ClFO2, Molecular Weight: 216.64, Synonym: 2-Chloro-6-fluorophenylacetic Acid Ethyl Ester, Form: Clear, Liquid, Color: Colorless - Slightly pale yellow, Size: 1G
MSDS SDS
Supplier:  Ricca Chemical
Description:   Sulfanilic acid 0.8% (w/v) in glacial acetic acid USP Test Solution (TS)
MSDS SDS
Small Business Enterprise

Supplier:  AMBEED, INC
Description:   (2-Methoxy-4-(trifluoromethoxy)phenyl)boronic acid, Purity: 95%, CAS Number: 355836-10-1, Appearance: Off white to yellow solid, Storage: Inert atmosphere, 2-8 C, Size: 100mg
Supplier:  AOB CHEM USA
Description:   3-(Dimethylcarbamoyl)phenylboronic acid ≥97%

Supplier:  AOB CHEM USA
Description:   4-(Isopropoxycarbonyl)phenylboronic acid ≥97%
Supplier:  AOB CHEM USA
Description:   4-Bromo-3-(trifluoromethyl)benzeneboronic acid ≥97%
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 054702-500MG , MDL Number: MFCD16090020
Supplier:  AMBEED, INC
Description:   Sodium 2-(4-nitrophenyl)acetate, Purity: 99%, CAS Number: 7063-24-3, Appearance: White to Orange to Green powder to crystal, Storage: Inert atmosphere, Room Temperature, Size: 5g
Supplier:  TCI America
Description:   CAS Number: 24552-27-0
MDL Number: MFCD00045298
Molecular Formula: C9H9ClO2
Molecular Weight: 184.62
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 157
Specific Gravity (20/20): 1.20
MSDS SDS
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier:  AMBEED, INC
Description:   Ethyl 3-(benzylamino)-3-oxopropanoate, Purity: 97%, CAS Number: 29689-63-2, Appearance: Form: Crystal - Powder/Colour: Very pale yellow - Pale yellow, Storage: Sealed in dry, Room Temperature, Size: 1g
Supplier:  AOB CHEM USA
Description:   2-(4-Bromo-2-fluoro-5-(trifluoromethyl)phenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane ≥97%
Supplier:  AMBEED, INC
Description:   2-(3-Fluoro-5-(trifluoromethyl)phenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane 95%
Supplier:  AMBEED, INC
Description:   N-(2-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)methanesulfonamide, Purity: 98%, CAS number: 380430-60-4, Appearance: Form: solid, Storage: Sealed in dry, Room Temperature, Size: 5G
Supplier:  AOB CHEM USA
Description:   2-Formyl-4-(trifluoromethyl)phenylboronic acid ≥97%
Supplier:  AMBEED, INC
Description:   2,5-Dioxopyrrolidin-1-yl 2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetate, Purity: 97%, CAS Number: 55750-61-3, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,009 - 1,024  of 158,087