Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl-3,5-dichlorobenzoate


59,481  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"59481"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   97%. 25g.
MSDS SDS
Supplier:  MORAVEK BIOCHEMICALS MS
Description:   2'-Fluoro 2'-deoxyuracil-β-D-arabinofuranoside 5'-monophosphate, ditriethylammonium salt ≥95% (by HPLC)
Supplier:  AMBEED, INC
Description:   5-Bromo-2,3-difluoroanisole 97%
Supplier:  AOB CHEM USA
Description:   1-(3-Bromo-6-chloro-2-fluorophenyl)propan-1-ol ≥95%
New Product
Supplier:  AOB CHEM USA
Description:   Cyclopropyl(4-methoxy-2-(trifluoromethyl)phenyl)methanol ≥95%
New Product
Supplier:  MilliporeSigma
Description:   For analysis for the determination of ascorbic acid
MSDS SDS
Supplier:  Rockland Immunochemical
Description:   Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI is a non-glycosylated polypeptide chain consisting of 209 amino acids with a molecular weight of 23.3 kDa.
Supplier:  AMBEED, INC
Description:   1-(tert-Butoxycarbonyl)-4-oxopiperidine-2-carboxylic acid 95%
Supplier:  AMBEED, INC
Description:   7-Chloro-1H-quinazoline-2,4-dione 95%
Supplier:  Anaspec Inc
Description:   All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Molecular Weight: 4329.9+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (470190-906)

Supplier:  SILICO & CHEMICO PORCELAIN SE
Description:   These porcelain dishes are both affordable and high quality.
Supplier:  AMBEED, INC
Description:   N-Acetylneuraminic acid 97%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 006907-1G , MDL Number: MFCD00152349
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 009069-5G , MDL Number: MFCD03094303
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 056571-1G , MDL Number: MFCD00060547
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043474-5G , MDL Number: MFCD00234623
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,153 - 7,168  of 59,481