Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Ditetradecyl-3,3\'-thiodipropionate


9,962  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"9962"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   (R)-1,3-Dimethylpiperazin-2-one ≥98%
New Product
Supplier:  AOB CHEM USA
Description:   2-(3-Chlorophenyl)-1,3,4-oxadiazole ≥97%
Catalog Number: (103003-366)

Supplier:  Anaspec Inc
Description:   Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
MW:5155.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  AOB CHEM USA
Description:   5-Bromo-2-(diethoxymethyl)pyridine ≥97%
Supplier:  Thermo Scientific Chemicals
Description:   An antibiotic used in the treatment of staphyloccoci bacteria that are resistant to penicillin G
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   5G
MSDS SDS
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, L-Nebivolol (RS,SS) HCl
Supplier:  AOB CHEM USA
Description:   4-Bromo-2-fluoro-5-methoxypyridine ≥97%

Supplier:  Ace Glass
Description:   All working parts and indicia are visible, meter readings are unobstructed; the outlet swivels 360°
Small Business Enterprise Product available on GSA Advantage®
Supplier:  AOB CHEM USA
Description:   4-Bromo-2-fluoro-3-methoxybenzonitrile ≥97%
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Methyl Acrylate
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Vismodegib-d4

Supplier:  Prosci
Description:   The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.
Supplier:  AMBEED, INC
Description:   2-Chloro-4-iodophenol 97%
Supplier:  Thermo Scientific Chemicals
Description:   98%
MSDS SDS

Supplier:  Enzo Life Sciences
Description:   Isotype: Mouse IgG1
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,769 - 4,784  of 9,962