Guanylurea+phosphate
Supplier:
AMBEED, INC
Description:
4-Hydroxyquinoline, Purity: 97%, CAS Number: 611-36-9, Appearance: Form: Crystal - Powder, Storage: Sealed in dry, Room Temperature, Size: 500g
Catalog Number:
(89085-540)
Supplier:
VWR International
Description:
These sample bags are ideal for transportation and storage of solids, semisolids, and liquids for environmental and carcass sampling, biomedical and pharmaceutical research, quality assurance procedures, food industry applications, and clinical and veterinary medicine.
Supplier:
AMBEED, INC
Description:
(R)-3-Cyclohexylmorpholine, Purity: 95+%, CAS number: 1269969-36-9, Appearance: Liquid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1G
Supplier:
AMBEED, INC
Description:
1-Chloro-3-(3-chloropropoxy)propane, Purity: 98%, CAS Number: 629-36-7, Appearance: Colorless to Yellow Liquid, Storage: Sealed in dry, 2-8 C, Size: 1g
Supplier:
Matrix Scientific
Description:
MF=C7H8N2O3S MW=200.22 Cas=1174534-36-1 1G
Catalog Number:
(BDH83621.400)
Supplier:
VWR International
Description:
Ethyl acetate ≥99.8%, HiPerSolv CHROMANORM® for HPLC, VWR Chemicals BDH®
Supplier:
TCI America
Description:
CAS Number: 13431-36-2
MDL Number: MFCD00025144
Molecular Formula: C4H11N3S
Molecular Weight: 133.21
Form: Crystal
Color: White
Melting point (°C): 97
Supplier:
AMBEED, INC
Description:
9-Phenyl-3,6-bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-9H-carbazole 97%
Supplier:
Shenandoah Biotechnology
Description:
Interleukin 36 gamma (IL-36 ɣ) is a member of the interleukin 1 (IL-1) cytokine family and protects against pathogens in the skin, lung, and stomach epithelial barriers. IL-36 ɣ binds the interleukin-1 receptor accessory protein (IL-1RAcP) and the orphan IL-1R-related protein 2 (IL-1Rrp2) receptors to activate NF-kB and MAP kinase signaling pathways, resulting in the induced production of inflammatory cytokines and chemokines.
Catalog Number:
(EM8.18316.0001)
Catalog Number:
(103008-200)
Supplier:
Anaspec Inc
Description:
This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2 MW: 3717.5 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(102867-688)
Supplier:
R&D Systems
Description:
The Recombinant Mouse IL-36 alpha/IL-1F6 (aa 8-160) Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-36 alpha/IL-1F6 (aa 8-160) Protein has been validated for the following applications: Bioactivity.
Supplier:
Matrix Scientific
Description:
MF=C6H4Br2 MW=235.92 Cas=108-36-1 MDL=MFCD00000078 100G
Supplier:
Anaspec Inc
Description:
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 MW: 3297.7 Da % Peak area by HPLC: 95 Storage condition: -20° C
Supplier:
AMBEED, INC
Description:
4-Chloro-7-methoxyquinoline-6-carboxamide, Purity: 97%, CAS Number: 417721-36-9, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||