Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-(4-Chlorophenyl)-2,2-difluoroacetic+acid


156,794  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"156794"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C15H10F3In2O4 MW=466.16 ,1G
Supplier:  AMBEED, INC
Description:   Chloro[[2,2'-[(1S,2S)-1,2-Cyclohexanediylbis[(nitrilo-KN)methylidyne]]bis[4-bis(1,1-dimethylethyl)-6-methyl-phenolato-KO]](2-)]cobalt, Purity: 97%, CAS Number: 2828438-48-6, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100MG
Supplier:  PeproTech, Inc.
Description:   Animal-Free Murine IL-22 Recombinant Protein, Purity: >98%, Source: E.coli, Biological Activity: By its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells), Synonyms: Interleukin-22
Supplier:  Rockland Immunochemical
Description:   Recombinant Human FGF-22 control protein
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis[3,5-bis(trifluoromethyl)phenyl]-5,5',6,6',7,7',8,8'-octahydro-1,1'-binaphthyl-2,2'-diyl Hydrogen Phosphate, Purity: 98%, CAS Number: 2229836-07-9, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   (R)-(-)-2,2'-Bis[di(3,5-di-i-propyl-4-dimethylaminophenyl)phosphino]-6,6'-dimethoxy-1,1'-biphenyl, Purity: 98%, CAS Number: 352655-40-4, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 1g
Supplier:  AMBEED, INC
Description:   1,3,2-Dioxathiane2,2-dioxide, Purity: 98%, CAS Number: 1073-05-8, Appearance: Form: crystalline Colour: white, Storage: Sealed in dry, Room Temperature, Size: 25g
Supplier:  AMBEED, INC
Description:   (R)-(6,6'-Dimethoxy-[1,1'-biphenyl]-2,2'-diyl)bis(bis(3,5-bis(trimethylsilyl)phenyl)phosphine), Purity: 98%, CAS Number: 150971-35-0, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 100MG
Supplier:  AMBEED, INC
Description:   (1R,1'R)-1,1',2,2',3,3',4,4'-Octahydro-1,1'-biisoquinoline, Purity: 97% 99%ee, CAS Number: 634180-49-7, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 100mg
Supplier:  AMBEED, INC
Description:   1-((3aR,8aR)-2,2-Dimethyl-4,4,8,8-tetraphenyltetrahydro-[1,3]dioxolo[4,5-e][1,3,2]dioxaphosphepin-6-yl)piperidine, Purity: 97%, CAS Number: 213843-95-9, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 1G
Supplier:  AMBEED, INC
Description:   Sodium 2,2'-disulfanediyldiethanesulfonate, Purity: 98%, CAS Number: 16208-51-8, Appearance: Powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 100MG
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 030940-500MG , MDL Number: MFCD08558498
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039797-500MG , MDL Number: MFCD00233310
Supplier:  AMBEED, INC
Description:   Iridium-(4,4'-difluoro-2,2'-bipyridine-κN1,κN1')bis[3,5-difluoro-2-(5-trifluoromethyl-2-pyridinyl-κN)phenyl-κC]-hexafluorophosphate ≥97%
New Product
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (1S,1'S)-1,1',2,2',3,3',4,4'-Octahydro-1,1'-biisoquinoline, Purity: 97% 99%ee, CAS Number: 634180-45-3, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 250MG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,617 - 7,632  of 156,794